Citrus Sinensis ID: 005753

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68
MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGVQNPIRSTQSVRSVKI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccHHHHccccccEEEEEccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEEHEEcccccccccccccccEEEEccccccEEEccccEEEEccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccEEEccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEECcccccccccccccccHHcccc
***************************************************************GRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSV**********************PPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAE********************************************************************************************ELTEVKKLLLK************NNLKIQVAQW***********F******************EIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVG************SV*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEASGNTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGVQNPIRSTQSVRSVKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Armadillo repeat-containing kinesin-like protein 3 probableQ9FZ06
Armadillo repeat-containing kinesin-like protein 2 probableQ5VQ09

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BG2, chain A
Confidence level:very confident
Coverage over the Query: 63-282,303-408
View the alignment between query and template
View the model in PyMOL
Template: 3B6U, chain A
Confidence level:very confident
Coverage over the Query: 74-279,302-318,329-416
View the alignment between query and template
View the model in PyMOL
Template: 2EFR, chain A
Confidence level:probable
Coverage over the Query: 482-509,520-590
View the alignment between query and template
View the model in PyMOL
Template: 3U1C, chain A
Confidence level:probable
Coverage over the Query: 526-615
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 523-658
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 409-491
View the alignment between query and template
View the model in PyMOL