Citrus Sinensis ID: 005753

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68

MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGVQNPIRSTQSVRSVKI

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccHHHHHcccccEEEEEccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEEHEEcccccccccccccccEEEEccccccEEEccccEEEEccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccEEEccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEcccccccccccccccHHcccc

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHccccEEEEEEcccccEEEEccccccccEEEEccEEEcccccHHHHHHHHcHHHHHHHHcccEEEEEEEccccccHHHHHcEccccccccEcHHHHHHHHHHHHHHcccccEEEEEEEEEEEHHHHHccccccccEEEEccccccEEEccccEEEEccHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEEEEEEcccccccccccccccEEEEEccccEEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHccccccEEEEEEEEccEHHHHHHHHHHHHHHHcccccEEEEccEEEccccccccccHHHHHHHHHHHHHHHccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHcHHHHHHHHEEEEEEcccccHEEEEccccccccccccccccEEEEcc

mannyrngtsnrsslaktdrplsvnsnskpavksrsfpasgprksspaslgsaavpkdyagvpgRVRVAVRLRTRNaeemvadadfgdCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVmaygqtgtgktytlgplgeedpatRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDlldptndnisiaedpktgdvslpgvtlvEIRDQHSFVELLKLGEAHRFAAntklntessrsHAFLMVHVKRSvegrdvahsgengnnshmvktlkppivrKAKLVVVDLAgseridksgseghtleEAKSINLSLSALGKCINslaegsayvpvrdsKLTRLLRdsfggtartslvitigpsprhrgetastILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQKDYMESIKKLEERWKINqqkqgsdrimvrseddcsdvaSNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKIQVAQWkrseasgntEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLsllffplfplffSCVSILFKIsvphatglllhnvgsrgvqnpirstqsvrsvki

mannyrngtsnrsslaktdrplsvnsnskpavksrsfpasgprksspaslgsaavpkdyagvpgrVRVAVRLRTRNaeemvadadfgdcVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQtgtgktytlgplgEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIaedpktgdvslPGVTLVEIRDQHSFVELLKLGEAHRFAANtklntessrshAFLMVHVKRSVEGRdvahsgengnnshmvktlkppivrKAKLVVVDLAgseridksgseghtleeAKSINLSLSALGKCINSLAegsayvpvrDSKLTRLLrdsfggtartslvitigpsprhrgetastilfgqrAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIeaqnqiseterNYADALEKERLKYQKDYMESIKKLEErwkinqqkqgsdrimvrSEDDCSDVASNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKiqvaqwkrseasgntEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLhnvgsrgvqnpirstqsvrsvki

MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYagvpgrvrvavrlrTRNAEEMVADADFGDCVellpelkrlklrkNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGeltevkklllketqlRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKleeeiallqsqllqisFEADEVRCIQNFFACCGLVlsllffplfplffsCVSILFKISVPHATGLLLHNVGSRGVQNPIRSTQSVRSVKI

**********************************************************YAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAE**KTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTK*********AFLMVHV**************************PPIVRKAKLVVVDLA********************INLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGP*******TASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAE**************I*****************************************************************************ELTEVKKLLLK************NNLKIQVAQW***********F******************EIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVG*******************

*******************************************************************VAVRLRTRNA***********CVELLP**************ETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSV**********************PPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLD**************************************************************************************************************************************************************************************************LLFFPLFPLFFSCVSILFKISVPHATGLL*****************SV*****

****************************************************AAVPKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQKDYMESIKKLEERWKI**********MVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGVQNPI***********

***************************************************************GRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGR*********NNSHMVKTLKPPIVRKAKLVVVDLAG*****************KSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHERQQK**********************NYADALEKERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLKETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQLLQISFEADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGV*N******SVRS***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERLKYQKDYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEASGNTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADEVRCIQNFFACCGLVLSLLFFPLFPLFFSCVSILFKISVPHATGLLLHNVGSRGVQNPIRSTQSVRSVKI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		679	2.2.26 [Sep-21-2011]
Q9FZ06		919	Armadillo repeat-containi	yes	no	0.886	0.655	0.717	0.0
Q5VQ09		891	Armadillo repeat-containi	yes	no	0.786	0.599	0.718	0.0
Q9LPC6		894	Armadillo repeat-containi	no	no	0.845	0.642	0.666	0.0
Q9SV36		1051	Armadillo repeat-containi	no	no	0.621	0.401	0.610	1e-146
Q0DV28		945	Armadillo repeat-containi	no	no	0.810	0.582	0.476	1e-140
Q54UC9		1193	Kinesin-related protein 3	yes	no	0.527	0.300	0.363	2e-61
O43093		935	Kinesin heavy chain OS=Sy	N/A	no	0.478	0.347	0.384	1e-60
P33176		963	Kinesin-1 heavy chain OS=	yes	no	0.410	0.289	0.423	3e-60
Q2PQA9		963	Kinesin-1 heavy chain OS=	yes	no	0.410	0.289	0.423	4e-60
P48467		928	Kinesin heavy chain OS=Ne	N/A	no	0.471	0.344	0.370	4e-60

>sp\|Q9FZ06\|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1	Back alignment and function desciption

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/612 (71%), Positives = 507/612 (82%), Gaps = 10/612 (1%)

Query: 4   NYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYAGVP 63
           +YRNGT  RSSL       + +   K +VKS+S      RKSSPA+LG  +      G  
Sbjct: 11  SYRNGT-QRSSLRTQSSASTSSGGQKASVKSKSVL----RKSSPAALGGGSSKSGGGGDA 65

Query: 64  G---RVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEF 120
           G   RVRVAVRLR RN EE++ADADF DCVEL PELKRLKLRKNNWD +T+EFDEVLTE+
Sbjct: 66  GVPGRVRVAVRLRPRNGEELIADADFADCVELQPELKRLKLRKNNWDTDTFEFDEVLTEY 125

Query: 121 ASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMED 180
           ASQKRVY+ VAKPVVE VLDGYNGT+MAYGQTGTGKTYTLG LGEED A RGIMVRAMED
Sbjct: 126 ASQKRVYEVVAKPVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMED 185

Query: 181 ILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQH 240
           ILA VSL+TDS++VSYLQLYMET+QDLLDP+NDNI+I EDPK GDVSLPG TLVEIRDQ 
Sbjct: 186 ILAEVSLETDSISVSYLQLYMETVQDLLDPSNDNIAIVEDPKNGDVSLPGATLVEIRDQQ 245

Query: 241 SFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTL 300
           SF+ELL+LGEAHRFAANTKLNTESSRSHA LMV+V+RS++ RD   S  NG NSHM K+L
Sbjct: 246 SFLELLQLGEAHRFAANTKLNTESSRSHAILMVNVRRSMKTRDGLSSESNG-NSHMTKSL 304

Query: 301 KPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPV 360
           KPP+VRK KLVVVDLAGSERI+KSGSEGHTLEEAKSINLSLSALGKCIN+LAE S++VP 
Sbjct: 305 KPPVVRKGKLVVVDLAGSERINKSGSEGHTLEEAKSINLSLSALGKCINALAENSSHVPF 364

Query: 361 RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDY 420
           RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGET STI+FGQRAMKVENM+K+KEEFDY
Sbjct: 365 RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETTSTIMFGQRAMKVENMVKIKEEFDY 424

Query: 421 KSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQK 480
           KSL+RRL++QLD LI E+ERQQKAF +EIERIT+EA NQISE E+ YA+ALE E+L+YQ 
Sbjct: 425 KSLSRRLEVQLDNLIEENERQQKAFVDEIERITVEAHNQISEAEKRYANALEDEKLRYQN 484

Query: 481 DYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLK 540
           DYMESIKKLEE W  NQ+K  ++R+ +  E +  D+ SN   S+A  + E++E+KKLL K
Sbjct: 485 DYMESIKKLEENWSKNQKKLAAERLAL-GEKNGLDITSNGNRSIAPALEEVSELKKLLQK 543

Query: 541 ETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQ 600
           E Q + AAEEEVN LK Q+ ++K+ EASGN+EI +L +MLE+E  QK+KLE EIA L SQ
Sbjct: 544 EAQSKMAAEEEVNRLKHQLNEFKKVEASGNSEIMRLHKMLENETQQKEKLEGEIATLHSQ 603

Query: 601 LLQISFEADEVR 612
           LLQ+S  ADE R
Sbjct: 604 LLQLSLTADETR 615

Arabidopsis thaliana (taxid: 3702)

>sp\|Q5VQ09\|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1	Back alignment and function description

>sp\|Q9LPC6\|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2	Back alignment and function description

>sp\|Q9SV36\|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2	Back alignment and function description

>sp\|Q0DV28\|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2	Back alignment and function description

>sp\|Q54UC9\|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1	Back alignment and function description

>sp\|O43093\|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1	Back alignment and function description

>sp\|P33176\|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens GN=KIF5B PE=1 SV=1	Back alignment and function description

>sp\|Q2PQA9\|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1	Back alignment and function description

>sp\|P48467\|KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kin PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		679
255537143		917	Kinesin heavy chain, putative [Ricinus c	0.891	0.659	0.813	0.0
297742660		827	unnamed protein product [Vitis vinifera]	0.889	0.730	0.778	0.0
297742663		774	unnamed protein product [Vitis vinifera]	0.889	0.780	0.780	0.0
359474063		779	PREDICTED: armadillo repeat-containing k	0.888	0.774	0.780	0.0
449459660		906	PREDICTED: armadillo repeat-containing k	0.876	0.656	0.762	0.0
356495631		884	PREDICTED: armadillo repeat-containing k	0.848	0.651	0.747	0.0
224074733		836	predicted protein [Populus trichocarpa]	0.782	0.635	0.802	0.0
359489421		895	PREDICTED: armadillo repeat-containing k	0.867	0.658	0.725	0.0
334182499		920	armadillo repeat-containing kinesin-like	0.886	0.654	0.717	0.0
18391394		919	armadillo repeat-containing kinesin-like	0.886	0.655	0.717	0.0

>gi\|255537143\|ref\|XP_002509638.1\| Kinesin heavy chain, putative [Ricinus communis] gi\|223549537\|gb\|EEF51025.1\| Kinesin heavy chain, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/612 (81%), Positives = 549/612 (89%), Gaps = 7/612 (1%)

Query: 3   NNYRNG--TSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGPRKSSPASLGSAAVPKDYA 60
           +NYRNG  +S+R+SL  + R LSVNSN K +VKS+S  +SG RKS+PASLG+A   KD A
Sbjct: 8   SNYRNGNYSSSRNSLNTSSRTLSVNSNPKNSVKSKSLTSSGLRKSAPASLGAA---KDDA 64

Query: 61  GVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKNNWDAETYEFDEVLTEF 120
           GVPGRVRVAVRLR RNAEEM ADADF DCVEL PE+KRLKLRKNNWD++TYEFDEVLTEF
Sbjct: 65  GVPGRVRVAVRLRPRNAEEMEADADFADCVELQPEVKRLKLRKNNWDSDTYEFDEVLTEF 124

Query: 121 ASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMED 180
           ASQKRVY+ VAKPVVESVLDGYNGTVMAYGQTGTGKTYTLG LGEED A RGIMVRAMED
Sbjct: 125 ASQKRVYEVVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMED 184

Query: 181 ILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQH 240
           ILA VSLDTDSV+VSYLQLYMETIQDLLDPTNDNISI EDPKTGDVSLPG  LVEIRDQ 
Sbjct: 185 ILADVSLDTDSVSVSYLQLYMETIQDLLDPTNDNISIVEDPKTGDVSLPGAILVEIRDQQ 244

Query: 241 SFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTL 300
           SF+ELL++GEAHRFAANTKLNTESSRSHA LMVHVK+SV+GRD A S EN NNSHMVK L
Sbjct: 245 SFLELLRIGEAHRFAANTKLNTESSRSHAILMVHVKKSVKGRDSALSSENHNNSHMVKNL 304

Query: 301 KPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVPV 360
           KPP+VRK KLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCIN+LAE S +VPV
Sbjct: 305 KPPVVRKGKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINALAENSPHVPV 364

Query: 361 RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDY 420
           RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTI+FGQRAMKVENMLKLKEEFDY
Sbjct: 365 RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTIMFGQRAMKVENMLKLKEEFDY 424

Query: 421 KSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERLKYQK 480
           KSLARRLDIQLDKLIAEHERQQKAFE EI+RITIEAQNQ+SE E+NYADAL+KERL YQK
Sbjct: 425 KSLARRLDIQLDKLIAEHERQQKAFEEEIKRITIEAQNQVSEVEKNYADALQKERLNYQK 484

Query: 481 DYMESIKKLEERWKINQQKQGSDRIMVRSEDDCSDVASNAKDSMASIVGELTEVKKLLLK 540
           +Y++SIKKLEE+W +NQQK  +D+++V   +DCSDVA+  K  ++ +  E+ E+KKLL K
Sbjct: 485 EYIDSIKKLEEKWTMNQQKHAADQMVVAPNNDCSDVAT--KREVSRMAEEIAEIKKLLQK 542

Query: 541 ETQLRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKLEEEIALLQSQ 600
           ET LRK A+EEVNNLK Q+AQ KRSEASGN+EI KLR+MLEDEA QK+KLE EIALLQ+Q
Sbjct: 543 ETVLRKGAQEEVNNLKSQLAQSKRSEASGNSEILKLRKMLEDEAFQKEKLEGEIALLQTQ 602

Query: 601 LLQISFEADEVR 612
           LLQ+SFEADE R
Sbjct: 603 LLQLSFEADETR 614

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297742660\|emb\|CBI34809.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297742663\|emb\|CBI34812.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359474063\|ref\|XP_003631396.1\| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449459660\|ref\|XP_004147564.1\| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like [Cucumis sativus] gi\|449513383\|ref\|XP_004164312.1\| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356495631\|ref\|XP_003516678.1\| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|224074733\|ref\|XP_002304445.1\| predicted protein [Populus trichocarpa] gi\|222841877\|gb\|EEE79424.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359489421\|ref\|XP_002273752.2\| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like [Vitis vinifera] gi\|296089163\|emb\|CBI38866.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334182499\|ref\|NP_001184972.1\| armadillo repeat-containing kinesin-like protein 3 [Arabidopsis thaliana] gi\|332190760\|gb\|AEE28881.1\| armadillo repeat-containing kinesin-like protein 3 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|18391394|ref|NP_563908.1| armadillo repeat-containing kinesin-like protein 3 [Arabidopsis thaliana] gi|75173334|sp|Q9FZ06.1|ARK3_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 3; AltName: Full=Phosphatidic acid kinase gi|9954168|gb|AAG08965.1|AF159052_1 kinesin-like protein [Arabidopsis thaliana] gi|162958327|dbj|BAF95587.1| armadillo repeat kinesin3 [Arabidopsis thaliana] gi|332190759|gb|AEE28880.1| armadillo repeat-containing kinesin-like protein 3 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		679
TAIR\|locus:2025497		915	ARK2 "armadillo repeat kinesin	0.860	0.638	0.601	4.1e-175
UNIPROTKB\|F1N945		995	KIF5C "Uncharacterized protein	0.572	0.390	0.350	2.6e-57
UNIPROTKB\|P46872		699	KRP85 "Kinesin-II 85 kDa subun	0.562	0.546	0.329	2.9e-54
UNIPROTKB\|E9PES4		726	KIF3A "Kinesin-like protein KI	0.478	0.447	0.362	4.8e-54
UNIPROTKB\|F1LS55		725	Kif3a "Protein Kif3a" [Rattus	0.478	0.448	0.359	6.1e-54
UNIPROTKB\|E1B999		726	KIF3A "Uncharacterized protein	0.478	0.447	0.362	6.1e-54
UNIPROTKB\|F1PSQ4		724	KIF3A "Uncharacterized protein	0.478	0.448	0.362	6.1e-54
UNIPROTKB\|F1RJV1		726	KIF3A "Uncharacterized protein	0.478	0.447	0.362	6.1e-54
UNIPROTKB\|Q5F423		739	KIF3B "Uncharacterized protein	0.674	0.619	0.317	3e-53
FB\|FBgn0004380		677	Klp64D "Kinesin-like protein a	0.568	0.570	0.352	2.7e-52

TAIR\|locus:2025497 ARK2 "armadillo repeat kinesin 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1701 (603.8 bits), Expect = 4.1e-175, P = 4.1e-175
 Identities = 371/617 (60%), Positives = 448/617 (72%)

Query:     1 MANNYRNGTSNRSSLAKTDRPLSVNSNSKPAVKSRSFPASGP--RKSSPASLGSA--AVP 56
             MA++ RNG   R S+       S N  S  + KSR  P+S P  R+SS AS+G+A   VP
Sbjct:     3 MASS-RNGAV-RGSMRPVSGANSSNLRSS-SFKSR-IPSSAPAPRRSSSASIGAADNGVP 58

Query:    57 KDYXXXXXXXXXXXXXXTRNAEEMVADADFGDCVXXXXXXXXXXXXXNNWDAETYEFDEV 116
                               RNA+E VADADF DCV             NNWD ETYEFDEV
Sbjct:    59 -------GRVRVAVRLRPRNADESVADADFADCVELQPELKRLKLRKNNWDTETYEFDEV 111

Query:   117 LTEFASQKRVYQAVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVR 176
             LTE ASQKRVY+ VAKPVVESVL+GYNGTVMAYGQTGTGKT+TLG LG+ED A RGIMVR
Sbjct:   112 LTEAASQKRVYEVVAKPVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVR 171

Query:   177 AMEDILAGVSLDTDSVTVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEI 236
             +MEDI+ G SLDTDS++VSYLQLYMETIQDLLDPTNDNI+I EDP+TGDVSLPG T VEI
Sbjct:   172 SMEDIIGGTSLDTDSISVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEI 231

Query:   237 RDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHM 296
             R+Q +F+ELL+LGE HR AANTKLNTESSRSHA LMVHVKRSV   +   S E  ++SH 
Sbjct:   232 RNQQNFLELLQLGETHRVAANTKLNTESSRSHAILMVHVKRSVVENEFPVSNEMESSSHF 291

Query:   297 VKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSA 356
             V+  KP +VR++KLV+VDLAGSER+ KSGSEGH LEEAKSINLSLSALGKCIN++AE S 
Sbjct:   292 VRPSKP-LVRRSKLVLVDLAGSERVHKSGSEGHMLEEAKSINLSLSALGKCINAIAENSP 350

Query:   357 YVPVRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKE 416
             +VP+RDSKLTRLLRDSFGGTARTSL++TIGPSPRHRGET STILFGQRAMKVENMLK+KE
Sbjct:   351 HVPLRDSKLTRLLRDSFGGTARTSLIVTIGPSPRHRGETTSTILFGQRAMKVENMLKIKE 410

Query:   417 EFDYKSLARRLDIQLDKLIAEHERQQKAFENEIERITIEAQNQISETERNYADALEKERL 476
             EFDYKSL+++L++QLDK+IAE+ERQ KAF++++ERI  +AQN+ISE E+N+A+ALEKE+L
Sbjct:   411 EFDYKSLSKKLEVQLDKVIAENERQLKAFDDDVERINRQAQNRISEVEKNFAEALEKEKL 470

Query:   477 KYQKDYMESIKKLEERWKINQQ--KQGSDRIMVRSEDDCSDVASNAKDSMASIVGXXXXX 534
             K Q +YMES+KKLEE+   NQ+  + G     V      S+  +  K+S+ + +      
Sbjct:   471 KCQMEYMESVKKLEEKLISNQRNHENGKRNGEVNGVVTASEF-TRLKESLENEM------ 523

Query:   535 XXXXXXXXXXRKAAEEEVNNLKIQVAQWKRSEASGNTEIFKLRQMLEDEAHQKKKXXXXX 594
                       RK+AEEEV+ +K Q     RS    +  I +L+++LEDEA QKKK     
Sbjct:   524 --------KLRKSAEEEVSKVKSQSTLKTRSGEGEDAGITRLQKLLEDEALQKKKLEEEV 575

Query:   595 XXXXXXXXXXXFEADEV 611
                        FEAD++
Sbjct:   576 TILRSQLVQLTFEADQI 592

GO:0003777 "microtubule motor activity" evidence=IEA;ISS

GO:0005524 "ATP binding" evidence=IEA

GO:0007018 "microtubule-based movement" evidence=IEA

GO:0048364 "root development" evidence=IMP

UNIPROTKB\|F1N945 KIF5C "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|P46872 KRP85 "Kinesin-II 85 kDa subunit" [Strongylocentrotus purpuratus (taxid:7668)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PES4 KIF3A "Kinesin-like protein KIF3A" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LS55 Kif3a "Protein Kif3a" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1B999 KIF3A "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PSQ4 KIF3A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RJV1 KIF3A "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5F423 KIF3B "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

FB\|FBgn0004380 Klp64D "Kinesin-like protein at 64D" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q5VQ09	ARK2_ORYSJ	No assigned EC number	0.7184	0.7864	0.5993	yes	no
Q9FZ06	ARK3_ARATH	No assigned EC number	0.7173	0.8865	0.6550	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		679
pfam00225		326	pfam00225, Kinesin, Kinesin motor domain	1e-113
smart00129		335	smart00129, KISc, Kinesin motor, catalytic domain	1e-108
cd00106		328	cd00106, KISc, Kinesin motor domain	1e-100
cd01369		325	cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine	1e-97
cd01366		329	cd01366, KISc_C_terminal, Kinesin motor domain, KI	4e-82
cd01372		341	cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik	8e-80
cd01370		338	cd01370, KISc_KIP3_like, Kinesin motor domain, KIP	5e-78
cd01371		333	cd01371, KISc_KIF3, Kinesin motor domain, kinesins	2e-77
cd01364		352	cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC	3e-77
cd01374		321	cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E	6e-76
cd01375		334	cd01375, KISc_KIF9_like, Kinesin motor domain, KIF	7e-74
cd01373		337	cd01373, KISc_KLP2_like, Kinesin motor domain, KLP	3e-68
COG5059		568	COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	5e-68
cd01365		356	cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K	2e-65
cd01376		319	cd01376, KISc_KID_like, Kinesin motor domain, KIF2	1e-64
cd01367		322	cd01367, KISc_KIF2_like, Kinesin motor domain, KIF	2e-60
cd01368		345	cd01368, KISc_KIF23_like, Kinesin motor domain, KI	5e-54
PLN03188		1320	PLN03188, PLN03188, kinesin-12 family protein; Pro	1e-47
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	5e-35
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	5e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	8e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-04
COG1579		239	COG1579, COG1579, Zn-ribbon protein, possibly nucl	9e-04
pfam05557		722	pfam05557, MAD, Mitotic checkpoint protein	0.002
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	0.002
pfam13166		713	pfam13166, AAA_13, AAA domain	0.004

>gnl\|CDD\|215803 pfam00225, Kinesin, Kinesin motor domain	Back alignment and domain information

 Score =  342 bits (880), Expect = e-113
 Identities = 144/348 (41%), Positives = 195/348 (56%), Gaps = 32/348 (9%)

Query: 71  RLRTRNAEEMVADADFGDCV-ELLPELKRLKLRKNNWDAETYEFDEVLTEFASQKRVYQA 129
           R+R  N  E    +     V E   E K   +  N    +T+ FD V    A+Q+ VY+ 
Sbjct: 1   RVRPLNEREKSRGSSDIVNVDETDSEDKESVVITNKGREKTFTFDRVFDPEATQEFVYEE 60

Query: 130 VAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDT 189
            AKP+VESVL+GYN T+ AYGQTG+GKTYT+   G+      GI+ RA+ED+   +    
Sbjct: 61  TAKPLVESVLEGYNVTIFAYGQTGSGKTYTM--EGDPPEEEPGIIPRALEDLFERIEERK 118

Query: 190 D-----SVTVSYLQLYMETIQDLLDPTNDN--ISIAEDPKTGDVSLPGVTLVEIRDQHSF 242
           +     SV VSYL++Y E I DLL P++    + I EDPK G V + G+T VE+      
Sbjct: 119 ERKWSFSVRVSYLEIYNEKIYDLLSPSSKKKKLRIREDPKKG-VYVKGLTEVEVTSAEEV 177

Query: 243 VELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSVEGRDVAHSGENGNNSHMVKTLKP 302
           +ELL+LG  +R  A+T +N ESSRSHA   + V                           
Sbjct: 178 LELLELGNKNRTVASTNMNEESSRSHAIFTITV-------------------EQRNRDTD 218

Query: 303 PIVRKAKLVVVDLAGSERIDKSG-SEGHTLEEAKSINLSLSALGKCINSLAEG-SAYVPV 360
             V+  KL +VDLAGSER  K+G + G  L+EA +IN SLSALG  IN+LAE  S+++P 
Sbjct: 219 GSVKTGKLNLVDLAGSERASKTGAAGGRRLKEAANINKSLSALGNVINALAENQSSHIPY 278

Query: 361 RDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKV 408
           RDSKLTRLL+DS GG ++T ++  I PS  +  ET ST+ F  RA  +
Sbjct: 279 RDSKLTRLLQDSLGGNSKTLMIANISPSDSNYEETLSTLRFASRAKNI 326

Length = 326

>gnl\|CDD\|214526 smart00129, KISc, Kinesin motor, catalytic domain	Back alignment and domain information

>gnl\|CDD\|238054 cd00106, KISc, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>gnl\|CDD\|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>gnl\|CDD\|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>gnl\|CDD\|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>gnl\|CDD\|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>gnl\|CDD\|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>gnl\|CDD\|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>gnl\|CDD\|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>gnl\|CDD\|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>gnl\|CDD\|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>gnl\|CDD\|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>gnl\|CDD\|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group	Back alignment and domain information

>gnl\|CDD\|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>gnl\|CDD\|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|218636 pfam05557, MAD, Mitotic checkpoint protein	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|221952 pfam13166, AAA_13, AAA domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		679
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	100.0
KOG4280		574	consensus Kinesin-like protein [Cytoskeleton]	100.0
PLN03188		1320	kinesin-12 family protein; Provisional	100.0
KOG0242		675	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01373		337	KISc_KLP2_like Kinesin motor domain, KLP2-like sub	100.0
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01370		338	KISc_KIP3_like Kinesin motor domain, KIP3-like sub	100.0
cd01368		345	KISc_KIF23_like Kinesin motor domain, KIF23-like s	100.0
cd01365		356	KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p	100.0
cd01364		352	KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind	100.0
cd01371		333	KISc_KIF3 Kinesin motor domain, kinesins II or KIF	100.0
cd01367		322	KISc_KIF2_like Kinesin motor domain, KIF2-like gro	100.0
cd01376		319	KISc_KID_like Kinesin motor domain, KIF22/Kid-like	100.0
cd01372		341	KISc_KIF4 Kinesin motor domain, KIF4-like subfamil	100.0
cd01369		325	KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy	100.0
cd01374		321	KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like	100.0
cd01375		334	KISc_KIF9_like Kinesin motor domain, KIF9-like sub	100.0
cd01366		329	KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/	100.0
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	100.0
smart00129		335	KISc Kinesin motor, catalytic domain. ATPase. Micr	100.0
KOG0247		809	consensus Kinesin-like protein [Cytoskeleton]	100.0
PF00225		335	Kinesin: Kinesin motor domain; InterPro: IPR001752	100.0
cd00106		328	KISc Kinesin motor domain. This catalytic (head) d	100.0
KOG0246		676	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	100.0
cd01363		186	Motor_domain Myosin and Kinesin motor domain. Thes	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	97.96
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.26
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.1
PRK11637		428	AmiB activator; Provisional	96.92
PHA02562		562	46 endonuclease subunit; Provisional	96.85
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	96.53
KOG0933		1174	consensus Structural maintenance of chromosome pro	96.44
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.39
PRK11637		428	AmiB activator; Provisional	96.37
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	96.37
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.36
KOG0971		1243	consensus Microtubule-associated protein dynactin	96.34
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	96.31
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	96.29
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	96.28
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	96.27
PRK02224		880	chromosome segregation protein; Provisional	96.27
PF00038		312	Filament: Intermediate filament protein; InterPro:	96.27
KOG0996		1293	consensus Structural maintenance of chromosome pro	96.25
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	96.24
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.16
KOG0971		1243	consensus Microtubule-associated protein dynactin	96.08
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	96.08
KOG0996		1293	consensus Structural maintenance of chromosome pro	96.08
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	96.04
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	96.04
COG4942		420	Membrane-bound metallopeptidase [Cell division and	95.99
KOG0933		1174	consensus Structural maintenance of chromosome pro	95.94
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	95.93
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.91
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	95.86
PHA02562		562	46 endonuclease subunit; Provisional	95.85
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	95.84
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	95.78
PF00038		312	Filament: Intermediate filament protein; InterPro:	95.73
COG4372		499	Uncharacterized protein conserved in bacteria with	95.7
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	95.68
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	95.65
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	95.63
KOG0963		629	consensus Transcription factor/CCAAT displacement	95.62
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	95.58
PRK02224		880	chromosome segregation protein; Provisional	95.42
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	95.42
KOG4673		961	consensus Transcription factor TMF, TATA element m	95.34
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	95.31
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	95.28
PRK04778		569	septation ring formation regulator EzrA; Provision	95.28
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	95.23
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	95.11
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	95.07
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	95.07
KOG1103		561	consensus Predicted coiled-coil protein [Function	95.02
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	95.0
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	94.97
PRK09039		343	hypothetical protein; Validated	94.95
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	94.94
PRK04863		1486	mukB cell division protein MukB; Provisional	94.92
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	94.91
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	94.88
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	94.85
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	94.81
KOG3850		455	consensus Predicted membrane protein [Function unk	94.8
PF14662		193	CCDC155: Coiled-coil region of CCDC155	94.67
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	94.62
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.62
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	94.6
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	94.54
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	94.49
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	94.49
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	94.39
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	94.36
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	94.21
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	94.2
PRK12704		520	phosphodiesterase; Provisional	94.15
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	94.13
PRK09039		343	hypothetical protein; Validated	94.07
KOG0963		629	consensus Transcription factor/CCAAT displacement	94.04
PRK04778		569	septation ring formation regulator EzrA; Provision	94.0
COG4477		570	EzrA Negative regulator of septation ring formatio	93.98
KOG4673		961	consensus Transcription factor TMF, TATA element m	93.97
PRK03918		880	chromosome segregation protein; Provisional	93.97
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	93.81
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	93.8
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	93.79
PRK10884		206	SH3 domain-containing protein; Provisional	93.78
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	93.77
PRK03918		880	chromosome segregation protein; Provisional	93.72
PRK04863		1486	mukB cell division protein MukB; Provisional	93.7
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	93.61
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	93.58
KOG0964		1200	consensus Structural maintenance of chromosome pro	93.54
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	93.4
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	93.35
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	93.26
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	93.25
KOG0964		1200	consensus Structural maintenance of chromosome pro	93.24
KOG0018		1141	consensus Structural maintenance of chromosome pro	93.15
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	93.11
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	93.0
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	92.93
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	92.89
PRK06893		229	DNA replication initiation factor; Validated	92.89
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	92.87
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	92.76
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	92.68
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	92.54
COG4942		420	Membrane-bound metallopeptidase [Cell division and	92.52
KOG4807		593	consensus F-actin binding protein, regulates actin	92.42
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	92.39
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	92.39
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	92.33
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	92.31
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	92.21
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	91.93
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	91.91
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	91.89
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	91.79
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	91.71
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	91.7
PRK11281		1113	hypothetical protein; Provisional	91.69
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	91.65
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	91.49
KOG1003		205	consensus Actin filament-coating protein tropomyos	91.48
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	91.38
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	91.37
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	91.34
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	91.26
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	91.24
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	91.24
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	91.06
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	91.05
PRK12704		520	phosphodiesterase; Provisional	91.04
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	90.98
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	90.87
PRK06620		214	hypothetical protein; Validated	90.78
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	90.67
PF14992		280	TMCO5: TMCO5 family	90.63
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	90.59
PRK01156		895	chromosome segregation protein; Provisional	90.53
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	90.47
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.45
KOG0249		916	consensus LAR-interacting protein and related prot	90.44
KOG0018		1141	consensus Structural maintenance of chromosome pro	90.37
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	90.35
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	90.34
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	90.18
COG4487		438	Uncharacterized protein conserved in bacteria [Fun	90.18
KOG4807		593	consensus F-actin binding protein, regulates actin	89.97
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	89.95
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	89.95
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	89.78
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.74
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	89.69
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	89.64
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	89.59
PRK12377		248	putative replication protein; Provisional	89.58
PRK05642		234	DNA replication initiation factor; Validated	89.54
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	89.5
PRK10884		206	SH3 domain-containing protein; Provisional	89.44
PRK08084		235	DNA replication initiation factor; Provisional	89.38
KOG4460		741	consensus Nuclear pore complex, Nup88/rNup84 compo	89.34
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	89.25
PRK14086		617	dnaA chromosomal replication initiation protein; P	89.16
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	88.97
PF13863		126	DUF4200: Domain of unknown function (DUF4200)	88.9
PRK09087		226	hypothetical protein; Validated	88.83
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	88.67
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	88.56
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	88.54
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	88.42
PRK00411		394	cdc6 cell division control protein 6; Reviewed	88.34
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	88.34
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	88.32
KOG0811		269	consensus SNARE protein PEP12/VAM3/Syntaxin 7/Synt	88.3
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	88.22
PRK08116		268	hypothetical protein; Validated	88.21
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	88.14
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	88.12
PRK07952		244	DNA replication protein DnaC; Validated	88.1
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	87.96
PRK00106		535	hypothetical protein; Provisional	87.96
PRK06526		254	transposase; Provisional	87.95
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	87.79
COG2433		652	Uncharacterized conserved protein [Function unknow	87.74
PRK00106		535	hypothetical protein; Provisional	87.74
PF15450		531	DUF4631: Domain of unknown function (DUF4631)	87.61
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	87.61
PRK14088		440	dnaA chromosomal replication initiation protein; P	87.56
PRK10929		1109	putative mechanosensitive channel protein; Provisi	87.56
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	87.51
KOG0810		297	consensus SNARE protein Syntaxin 1 and related pro	87.45
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	87.45
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	87.39
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	87.38
COG4372		499	Uncharacterized protein conserved in bacteria with	87.37
KOG0972		384	consensus Huntingtin interacting protein 1 (Hip1)	87.37
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	87.35
KOG0979		1072	consensus Structural maintenance of chromosome pro	87.33
COG2433		652	Uncharacterized conserved protein [Function unknow	87.29
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	87.12
COG4026		290	Uncharacterized protein containing TOPRIM domain,	87.1
PRK00149		450	dnaA chromosomal replication initiation protein; R	87.09
KOG1103		561	consensus Predicted coiled-coil protein [Function	87.01
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	86.78
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	86.76
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	86.48
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	86.09
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	86.05
PF14992		280	TMCO5: TMCO5 family	86.04
PRK08939		306	primosomal protein DnaI; Reviewed	85.81
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	85.77
PRK06835		329	DNA replication protein DnaC; Validated	85.68
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	85.51
PRK14087		450	dnaA chromosomal replication initiation protein; P	85.5
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	85.41
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	85.3
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	85.25
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	85.11
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	85.1
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	85.03
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	85.03
PTZ00112		1164	origin recognition complex 1 protein; Provisional	85.01
KOG2264		907	consensus Exostosin EXT1L [Signal transduction mec	84.99
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	84.82
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	84.62
PRK08181		269	transposase; Validated	84.5
PLN02939		977	transferase, transferring glycosyl groups	84.5
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	84.46
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	84.43
PF10186		302	Atg14: UV radiation resistance protein and autopha	84.43
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	84.39
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	84.36
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	84.11
COG5185		622	HEC1 Protein involved in chromosome segregation, i	83.85
PRK08903		227	DnaA regulatory inactivator Hda; Validated	83.74
PRK10869		553	recombination and repair protein; Provisional	83.72
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	83.63
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	83.49
PF14389		88	Lzipper-MIP1: Leucine-zipper of ternary complex fa	83.34
PRK08727		233	hypothetical protein; Validated	83.27
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	83.24
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	82.85
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	82.58
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	82.53
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	82.51
KOG0577		948	consensus Serine/threonine protein kinase [Signal	82.41
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	82.36
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	82.36
COG5185		622	HEC1 Protein involved in chromosome segregation, i	82.22
COG4026		290	Uncharacterized protein containing TOPRIM domain,	81.98
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	81.69
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	81.68
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	81.52
TIGR02231		525	conserved hypothetical protein. This family consis	81.49
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	81.45
PF13245		76	AAA_19: Part of AAA domain	81.39
COG1484		254	DnaC DNA replication protein [DNA replication, rec	81.38
PF13166		712	AAA_13: AAA domain	81.15
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	81.04
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	80.99
PF03904		230	DUF334: Domain of unknown function (DUF334); Inter	80.93
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	80.87
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	80.84
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	80.81
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	80.8
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	80.78
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	80.75
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	80.67
PRK10929		1109	putative mechanosensitive channel protein; Provisi	80.49
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	80.47
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	80.39
COG0593		408	DnaA ATPase involved in DNA replication initiation	80.17
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	80.1

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

Probab=100.00  E-value=1.9e-94  Score=828.72  Aligned_cols=367  Identities=35%  Similarity=0.525  Sum_probs=324.4

Q ss_pred             CCCCCCCCCCeEEEEecCCCCchhhhccCCCCceEEeCCCceEEEeccC--C-CCCcceeeccccCCCCChHHHHHHhhH
Q 005753           56 PKDYAGVPGRVRVAVRLRTRNAEEMVADADFGDCVELLPELKRLKLRKN--N-WDAETYEFDEVLTEFASQKRVYQAVAK  132 (679)
Q Consensus        56 ~~~~~~~~~~VrV~vRvRP~~~~E~~~~~~~~~~v~~~~~~~~~~~~~~--~-~~~~~F~FD~VF~~~asQ~~Vy~~~~~  132 (679)
                      .+++.....||+|+|||||++.+|.....  ..+|..++..+.+.++.+  + .-.++|+||+||+|.+.|++||+.++.
T Consensus        41 ~k~~~e~~~NIqVivRcRp~n~~E~~~~s--~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~  118 (1041)
T KOG0243|consen   41 SKDHKEKEVNIQVIVRCRPRNDRERKSKS--SVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVS  118 (1041)
T ss_pred             cCCCCCCCCceEEEEEeCCCCchhhhcCC--CeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHH
Confidence            45555555799999999999999976543  334555544444655544  2 246789999999999999999999999


Q ss_pred             HHHHHHhcCcceEEEeeccCCCCccccccC----CCCCCCCCcchHHHHHHHHHhccccC--CCeEEEEEEEeecceeee
Q 005753          133 PVVESVLDGYNGTVMAYGQTGTGKTYTLGP----LGEEDPATRGIMVRAMEDILAGVSLD--TDSVTVSYLQLYMETIQD  206 (679)
Q Consensus       133 plV~~~l~G~N~tIfaYGqTgSGKTyTm~G----~g~~~~~~~GIipra~~~LF~~i~~~--~~~V~vS~lEIYnE~v~D  206 (679)
                      |+|+.|+.|||||||||||||+||||||.|    .+.+.+...||||||+.+||..+...  .++|+|||+|+|||.|+|
T Consensus       119 p~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~~EYsvKVSfLELYNEEl~D  198 (1041)
T KOG0243|consen  119 PIIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQGAEYSVKVSFLELYNEELTD  198 (1041)
T ss_pred             HHHHHHhccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcCCeEEEEEEehhhhhHHHHH
Confidence            999999999999999999999999999977    23456778999999999999998765  579999999999999999


Q ss_pred             cCCCCCC---cceeeecC----CCCCeecCCcEEEEecChhHHHHHHHhhhhhcccccccccccccCcceEEEEEEEEee
Q 005753          207 LLDPTND---NISIAEDP----KTGDVSLPGVTLVEIRDQHSFVELLKLGEAHRFAANTKLNTESSRSHAFLMVHVKRSV  279 (679)
Q Consensus       207 LL~~~~~---~l~i~ed~----~~G~v~v~glt~~~V~s~ee~~~lL~~G~~~R~~~~T~~N~~SSRSH~Ifti~v~~~~  279 (679)
                      ||++...   .+.+.+++    .+|+|+|+||.++.|+++.|++.+|.+|.+.|++|+|.||..|||||+||+|+|+...
T Consensus       199 LLa~~~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike  278 (1041)
T KOG0243|consen  199 LLASEDTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKE  278 (1041)
T ss_pred             hcCCccccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEec
Confidence            9998643   46666666    6788999999999999999999999999999999999999999999999999997653


Q ss_pred             cccccccCCCCCCCccccccCCCCeEEeeeEEEEecCCCccccCCCCCcccHHHHHHhhhhHHHHHHHHHHhccCCCCcc
Q 005753          280 EGRDVAHSGENGNNSHMVKTLKPPIVRKAKLVVVDLAGSERIDKSGSEGHTLEEAKSINLSLSALGKCINSLAEGSAYVP  359 (679)
Q Consensus       280 ~~~~~~~~~~~~~~s~~~~~~~~~~~~~skL~fVDLAGSER~~~t~~~g~rlkE~~~IN~SL~aLg~vI~aL~~~~~~VP  359 (679)
                      ....                 ....++.|||+||||||||.+.++|+.+.|.+|++.||+||++||+||+||++++.|||
T Consensus       279 ~t~~-----------------geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s~HIP  341 (1041)
T KOG0243|consen  279 NTPE-----------------GEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHSGHIP  341 (1041)
T ss_pred             CCCc-----------------chhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccCCCCC
Confidence            2211                 11467889999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcccccccccccCCCCceeeeEecCCCCCChHHhHHHHHHHHHhhccccccccccccCHHHHHHHHHHHHHHHHHHHH
Q 005753          360 VRDSKLTRLLRDSFGGTARTSLVITIGPSPRHRGETASTILFGQRAMKVENMLKLKEEFDYKSLARRLDIQLDKLIAEHE  439 (679)
Q Consensus       360 yRdSKLTrLLqdsLgGnskt~mI~tIsP~~~~~~ETlsTL~fa~rak~I~n~~~v~~~~~~~~l~~~l~~e~~~L~~e~e  439 (679)
                      ||+|||||||||||||.++|+|||||||+..+++||++||.||.|||+|+|+|.+|.-...+.+++.|-.|+++|+.++.
T Consensus       342 YRESKLTRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~dl~  421 (1041)
T KOG0243|consen  342 YRESKLTRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRDLA  421 (1041)
T ss_pred             chHHHHHHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988765


Q ss_pred             HH
Q 005753          440 RQ  441 (679)
Q Consensus       440 ~~  441 (679)
                      -.
T Consensus       422 Aa  423 (1041)
T KOG0243|consen  422 AA  423 (1041)
T ss_pred             Hh
Confidence            43

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>KOG4280 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0242 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group	Back alignment and domain information

>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>smart00129 KISc Kinesin motor, catalytic domain	Back alignment and domain information

>KOG0247 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>cd00106 KISc Kinesin motor domain	Back alignment and domain information

>KOG0246 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01363 Motor_domain Myosin and Kinesin motor domain	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>KOG3850 consensus Predicted membrane protein [Function unknown]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>COG4487 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13863 DUF4200: Domain of unknown function (DUF4200)	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG0811 consensus SNARE protein PEP12/VAM3/Syntaxin 7/Syntaxin 17 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF15450 DUF4631: Domain of unknown function (DUF4631)	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0810 consensus SNARE protein Syntaxin 1 and related proteins [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF14389 Lzipper-MIP1: Leucine-zipper of ternary complex factor MIP1	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02231 conserved hypothetical protein	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

Homologous Structure Templates