Citrus Sinensis ID: 005754

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68

MPGFDSVETPNGDLTDCPYQSNDCSPARDLLHQLPSLMSSCYPITLKFIDVCYRIKIENKSKEGSSFRRIFNRGSTSSTDDQGSTAKIQERTILNGITGMVSPGEILAILGPSGSGKSTMLNVLAGRLHQGHGLTGTILTNNNKPTKHISKRTGFVTQDDILYPHLTVRETLVFCSLLRLPRTLSTKEKTSIAEAVMAELGLTKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDSTAAYRLVSTLGSLVQRGKTIVTSMHQPSSRVYQMFDKVLVLSEGRCLYFGKGSEAMSYFESVGFSPSFPMNPADFLLDLANGVYHLDGVSEREKPNVKSSIVASYNTLLAPKVRAACMEATTLPRREALLTGSSSSSHSSEEHTRSHNNNVIGFATWLNQFSILLHRSLKERKHESLNTLRVFQVIAASLLSGIMWWHSDFREVQDRLGLFFFISVFWGVLPSVNAVFAFPQERAIFMKERASGMYTLSSYFMSRIIGDLPVELILPTVFLIIIYWMTGFKPEFIAFVQTLLVLLGYVLVSQGLGLALGAIIMDAKQASTIVTVTMLAFVLTGGYYVHKMPSCIAWIKYISSTYYNYRLLINVQYGDGKKISYLLGCFDRHGSSRDASCKFVEEDIVGQISPLVSIGAFLSMFVGYRLLAYLALRRLKA

cccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccCEEECccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHcccEEEEccccEEEEcccccHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc

***********************************SLMSSCYPITLKFIDVCYRIKIENKSKEGSSFRRIFNRGSTS*************RTILNGITGMVSPGEILAILGPSGSGKSTMLNVLAGRLHQGHGLTGTILTNNNKPTKHISKRTGFVTQDDILYPHLTVRETLVFCSLLRLPRTLSTKEKTSIAEAVMAELGLTKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDSTAAYRLVSTLGSLVQRGKTIVTSMHQPSSRVYQMFDKVLVLSEGRCLYFGKGSEAMSYFESVGFSPSFPMNPADFLLDLANGVYHLDGVS*******KSSIVASYNTLLAPKVRAACMEAT****************************NVIGFATWLNQFSILLHRSLKERKHESLNTLRVFQVIAASLLSGIMWWHSDFREVQDRLGLFFFISVFWGVLPSVNAVFAFPQERAIFMKERASGMYTLSSYFMSRIIGDLPVELILPTVFLIIIYWMTGFKPEFIAFVQTLLVLLGYVLVSQGLGLALGAIIMDAKQASTIVTVTMLAFVLTGGYYVHKMPSCIAWIKYISSTYYNYRLLINVQYGDGKKISYLLGCFDRHGSSRDASCKFVEEDIVGQISPLVSIGAFLSMFVGYRLLAYLALRRLKA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABC transporter G family member 25		probable	Q84TH5
Protein white	Part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color. White dimerize with brown for the transport of guanine. Scarlet and white complex transports a metabolic intermediate (such as 3-hydroxy kynurenine) from the cytoplasm into the pigment granules.	probable	P10090

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZU0, chain C
Confidence level:very confident
Coverage over the Query: 89-314
View the alignment between query and template
View the model in PyMOL

Template: 1VCI, chain A
Confidence level:probable
Coverage over the Query: 92-338
View the alignment between query and template
View the model in PyMOL