Citrus Sinensis ID: 005788
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 677 | ||||||
| 255571020 | 889 | conserved hypothetical protein [Ricinus | 0.865 | 0.659 | 0.782 | 0.0 | |
| 147789454 | 1817 | hypothetical protein VITISV_012096 [Viti | 0.936 | 0.348 | 0.703 | 0.0 | |
| 449503321 | 942 | PREDICTED: ion channel DMI1-like [Cucumi | 0.940 | 0.676 | 0.688 | 0.0 | |
| 449435486 | 915 | PREDICTED: ion channel DMI1-like [Cucumi | 0.939 | 0.695 | 0.686 | 0.0 | |
| 225448136 | 818 | PREDICTED: ion channel DMI1 [Vitis vinif | 0.785 | 0.650 | 0.801 | 0.0 | |
| 224129674 | 711 | predicted protein [Populus trichocarpa] | 0.673 | 0.641 | 0.892 | 0.0 | |
| 224119998 | 693 | predicted protein [Populus trichocarpa] | 0.651 | 0.636 | 0.922 | 0.0 | |
| 357445307 | 882 | DMI1 protein [Medicago truncatula] gi|62 | 0.899 | 0.690 | 0.642 | 0.0 | |
| 161105393 | 894 | SYM8 [Pisum sativum] | 0.929 | 0.703 | 0.656 | 0.0 | |
| 133740540 | 894 | DMI1 protein homologue [Pisum sativum] | 0.929 | 0.703 | 0.656 | 0.0 |
| >gi|255571020|ref|XP_002526461.1| conserved hypothetical protein [Ricinus communis] gi|223534241|gb|EEF35956.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 935 bits (2416), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 469/599 (78%), Positives = 515/599 (85%), Gaps = 13/599 (2%)
Query: 77 NERDWMYPSFLGPHM---GRRRIKVKPSK----LEFKGNEEKKRIQELGSKKEEKAVASL 129
+ RDW+YPSFLGPH+ G R+ VK + E KG + ++E +K+EK + +
Sbjct: 45 DSRDWVYPSFLGPHVVAAGANRVTVKGRRGKVVEERKGTVSRDSVKE---EKKEKVASQV 101
Query: 130 AVTQSNSVTQTSSVTQLSGRT-RGLKSSLMTYYMLIINCILCVCYAIHLRDRVEKLEEEN 188
VTQS S+TQ+++ + RT RGL +Y LI CIL V +IHLR +V KLEEEN
Sbjct: 102 LVTQSGSLTQSTATGVIRSRTSRGLFKHSFVFYFLIFTCILSVSCSIHLRIKVRKLEEEN 161
Query: 189 SSLRRFCSYKSIAGNNGIDVLHTDNNSDSNFGNADGRTVALYSVIVTLLMPFVLYKYLDY 248
+LR CS +S GNN I+VL +++S NF N D R VALYSVI TL+MPF+ YKYLDY
Sbjct: 162 INLRTACSNQSGVGNNSIEVLQLEDDSSFNFQNGDSRAVALYSVIFTLIMPFLFYKYLDY 221
Query: 249 LPQIKNFSKRTKKNKEEVPLKKRVAYSVDVCFSVYPYAKLLALLFATIFLIIFGGLALYA 308
LP+IK SKRT+ NKEEVPLKKR+AY VDV FSVYPYAKLLALLFATIFLI FGGLALYA
Sbjct: 222 LPEIKTLSKRTRNNKEEVPLKKRIAYMVDVFFSVYPYAKLLALLFATIFLIGFGGLALYA 281
Query: 309 VSDSSFAEALWLSWTFVADSGNHADRVGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK 368
VSD SFAEALWLSWTFVADSGNHADR+GTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK
Sbjct: 282 VSDGSFAEALWLSWTFVADSGNHADRIGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEK 341
Query: 369 VDSLRKGKSEVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDI 428
VDSLRKGKSEVIEK HILILGWSDKLGSLLKQLA+ANKSIGGGV+VVLAERDKEEMEMDI
Sbjct: 342 VDSLRKGKSEVIEKKHILILGWSDKLGSLLKQLAIANKSIGGGVVVVLAERDKEEMEMDI 401
Query: 429 AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLT 488
AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDA ALRVVLSLT
Sbjct: 402 AKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDAHALRVVLSLT 461
Query: 489 GVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI 548
GVKEGL+GHVVVEMSD+DNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI
Sbjct: 462 GVKEGLKGHVVVEMSDVDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDI 521
Query: 549 LGFENAEFYIKRWPQLDDLRFEEVVISFPDAIPCGIKVAAEGGKIILNPDDNYVLKEGDE 608
LGFENAEFYIKRWPQLD LRFE+V+ISFPDAIPCG+K+AAEGGKI LNPDD+YVLKEGDE
Sbjct: 522 LGFENAEFYIKRWPQLDGLRFEDVLISFPDAIPCGVKLAAEGGKINLNPDDSYVLKEGDE 581
Query: 609 VLVIAEDDDTYAPGPLPEVCKRSFLKIPDPPKYPEKILFCGWRRDIDDMIMVIFLQLCL 667
+LVIAEDDDTYAPGPLP+V + S K+ DPPKYPEKILFCGWRRDIDDMIMV L+ CL
Sbjct: 582 ILVIAEDDDTYAPGPLPKVRRGSCPKLIDPPKYPEKILFCGWRRDIDDMIMV--LEECL 638
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147789454|emb|CAN73312.1| hypothetical protein VITISV_012096 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449503321|ref|XP_004161944.1| PREDICTED: ion channel DMI1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449435486|ref|XP_004135526.1| PREDICTED: ion channel DMI1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225448136|ref|XP_002263318.1| PREDICTED: ion channel DMI1 [Vitis vinifera] gi|297739532|emb|CBI29714.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224129674|ref|XP_002328774.1| predicted protein [Populus trichocarpa] gi|222839072|gb|EEE77423.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224119998|ref|XP_002331112.1| predicted protein [Populus trichocarpa] gi|222872840|gb|EEF09971.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357445307|ref|XP_003592931.1| DMI1 protein [Medicago truncatula] gi|62286545|sp|Q6RHR6.1|DMI1_MEDTR RecName: Full=Ion channel DMI1; AltName: Full=Does not make infections protein 1 gi|44953222|gb|AAS49490.1| DMI1 protein [Medicago truncatula] gi|92870250|gb|ABE79577.1| Ion channel DMI-1 , putative [Medicago truncatula] gi|355481979|gb|AES63182.1| DMI1 protein [Medicago truncatula] gi|357394659|gb|AET75788.1| DMI1 [Cloning vector pHUGE-MtNFS] gi|357394672|gb|AET75800.1| DMI1 [Cloning vector pHUGE-LjMtNFS] | Back alignment and taxonomy information |
|---|
| >gi|161105393|gb|ABX57723.1| SYM8 [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|133740540|emb|CAJ00334.2| DMI1 protein homologue [Pisum sativum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 677 | ||||||
| UNIPROTKB|Q4VY51 | 894 | SYM8 "Probable ion channel SYM | 0.905 | 0.685 | 0.638 | 7.9e-205 | |
| TAIR|locus:2158799 | 824 | AT5G49960 [Arabidopsis thalian | 0.720 | 0.592 | 0.721 | 6.4e-186 | |
| TAIR|locus:505006671 | 817 | AT5G43745 [Arabidopsis thalian | 0.440 | 0.364 | 0.253 | 1.5e-22 | |
| TAIR|locus:2151276 | 813 | AT5G02940 [Arabidopsis thalian | 0.440 | 0.366 | 0.230 | 3.2e-21 | |
| UNIPROTKB|O27564 | 336 | mthK "Calcium-gated potassium | 0.237 | 0.479 | 0.237 | 6.5e-10 |
| UNIPROTKB|Q4VY51 SYM8 "Probable ion channel SYM8" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
Score = 1951 (691.8 bits), Expect = 7.9e-205, Sum P(2) = 7.9e-205
Identities = 404/633 (63%), Positives = 466/633 (73%)
Query: 39 PAVRRT----DKP-FDLRVSIXXXXXXXXXXXXXXXXXXXNGFNERDWMYPSFLG-PHMG 92
P ++RT +P +LRVSI F ++ YPSFLG
Sbjct: 17 PPLKRTKTLAQQPSLNLRVSIAAADNGIGNSSSSSTKTD---FEQQQRNYPSFLGIGSTS 73
Query: 93 RRRIKVKPSKLEFKGNEEKKRIQELGSKKEEKAVASLAXXXXXXXXXXXXXXXLSGRTRG 152
R+R P K K + +K + S + +
Sbjct: 74 RKRRPPPPPKPSNITPNVKPPASDFQTKPHSEPKTSPSSSSPPSLPIAITKQ--QQQQHS 131
Query: 153 LKSSLMTYYMLIINCILCVCYAIHLRDRVEKLEEENSSLRRFCSYKSIAGNNGIDVLHTD 212
+ S + +Y+ +I C++ V Y+ L+ ++ KL++ L C NG L D
Sbjct: 132 ISSPI--FYLFVITCVIFVPYSAFLQYKLAKLKDMKLQL---CCQIDFCSGNGKTSLQKD 186
Query: 213 NNSDSNFG----NADGRTVALYSVIVTLLMPFVLYKYLDYLPQIKNFSKRTKKNKEEVPL 268
D +F NAD RT++LY V+ TL++PF+LYKY+DYLPQ+ NFS+RT NKE+VPL
Sbjct: 187 VVDDGSFSYYILNADSRTISLYIVLFTLVLPFILYKYIDYLPQMINFSRRTNSNKEDVPL 246
Query: 269 KKRVAYSVDVCFSVYPYAKXXXXXXXXXXXXXXXXXALYAVSDSSFAEALWLSWTFVADS 328
KKRVAY VDV FS+YPYAK ALYAV+ S AEALW SWT+VAD+
Sbjct: 247 KKRVAYMVDVFFSIYPYAKLLALLFATLFLIAFGGLALYAVTGGSMAEALWHSWTYVADA 306
Query: 329 GNHADRVGTGPRIVSVSISSGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIEKNHILIL 388
GNHA+ G G RIVSVSIS+GGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIE+NH+LIL
Sbjct: 307 GNHAETEGMGQRIVSVSISAGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIERNHVLIL 366
Query: 389 GWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPL 448
GWSDKLGSLLKQLA+ANKS+GGGVIVVLAE++KEEMEMDIAKLEFDFMGTSVICRSGSPL
Sbjct: 367 GWSDKLGSLLKQLAIANKSVGGGVIVVLAEKEKEEMEMDIAKLEFDFMGTSVICRSGSPL 426
Query: 449 ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNE 508
ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKE LRGHVVVEMSDLDNE
Sbjct: 427 ILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEALRGHVVVEMSDLDNE 486
Query: 509 PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPQLDDLR 568
PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWP+LD L
Sbjct: 487 PLVKLVGGELIETVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPELDGLL 546
Query: 569 FEEVVISFPDAIPCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIAEDDDTYAPGPLPEVC 628
F++++ISFPDAIPCG+KV+A+GGKI++NPDDNYVL++GDEVLVIAEDDDTYAPGPLPEV
Sbjct: 547 FKDILISFPDAIPCGVKVSADGGKIVINPDDNYVLRDGDEVLVIAEDDDTYAPGPLPEVR 606
Query: 629 KRSFLKIPDPPKYPEKILFCGWRRDIDDMIMVI 661
K F +I DPPKYPEKILFCGWRRDIDDMIMV+
Sbjct: 607 KGYFPRIRDPPKYPEKILFCGWRRDIDDMIMVL 639
|
|
| TAIR|locus:2158799 AT5G49960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006671 AT5G43745 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151276 AT5G02940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O27564 mthK "Calcium-gated potassium channel MthK" [Methanothermobacter thermautotrophicus str. Delta H (taxid:187420)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 677 | |||
| pfam06241 | 208 | pfam06241, DUF1012, Protein of unknown function (D | 5e-13 | |
| COG0569 | 225 | COG0569, TrkA, K+ transport systems, NAD-binding c | 0.004 |
| >gnl|CDD|114933 pfam06241, DUF1012, Protein of unknown function (DUF1012) | Back alignment and domain information |
|---|
Score = 68.2 bits (166), Expect = 5e-13
Identities = 43/153 (28%), Positives = 81/153 (52%), Gaps = 5/153 (3%)
Query: 461 ARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIE 520
ARAII+L + + + D A VL+L +++ +VE+S + L+K + G +E
Sbjct: 1 ARAIIILPTKGDRYEVDTDAFLSVLALEPIQKMESIPTIVEVSSPNMYDLLKSISGLKVE 60
Query: 521 TVVAHDVIGRLMIQCALQPGLAQIWEDILGFENAEFYIKRWPQLDDLRFEEVVISFPDAI 580
V + +L +QC+ Q L +I+ +L + F + +P L +++ ++ + F + +
Sbjct: 61 PV--ENSTSKLFVQCSRQKDLIKIYRHLLNYSKNVFNLCSFPNLTGMKYRQLRLGFQEVV 118
Query: 581 PCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIA 613
CGI GK+ +P+D+ L E D++L IA
Sbjct: 119 VCGI---LRDGKVNFHPNDDEELMETDKLLFIA 148
|
Family of uncharacterized proteins found in both eukaryotes and bacteria. Length = 208 |
| >gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 677 | |||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.97 | |
| PF06241 | 206 | DUF1012: Protein of unknown function (DUF1012); In | 99.95 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 99.91 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.91 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 99.9 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 99.88 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 99.75 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 99.73 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 99.67 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 99.66 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 99.64 | |
| COG1226 | 212 | Kch Kef-type K+ transport systems, predicted NAD-b | 98.95 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 98.92 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 98.62 | |
| COG0490 | 162 | Putative regulatory, ligand-binding protein relate | 98.4 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.29 | |
| COG3400 | 471 | Uncharacterized protein conserved in bacteria [Fun | 98.26 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 98.16 | |
| PF02080 | 71 | TrkA_C: TrkA-C domain; InterPro: IPR006037 The reg | 98.14 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 98.12 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 98.12 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.51 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 97.35 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 97.19 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 97.19 | |
| COG3273 | 204 | Uncharacterized conserved protein [Function unknow | 97.11 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 97.03 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.95 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 96.95 | |
| PF03493 | 101 | BK_channel_a: Calcium-activated BK potassium chann | 96.87 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 96.84 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 96.32 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 96.1 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 95.9 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 95.73 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 95.66 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 95.57 | |
| PRK05326 | 562 | potassium/proton antiporter; Reviewed | 95.53 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 94.81 | |
| PRK04972 | 558 | putative transporter; Provisional | 94.57 | |
| TIGR03802 | 562 | Asp_Ala_antiprt aspartate-alanine antiporter. All | 94.38 | |
| PRK03818 | 552 | putative transporter; Validated | 94.12 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 94.11 | |
| PRK03818 | 552 | putative transporter; Validated | 94.08 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 93.69 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 93.03 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 92.88 | |
| PRK04972 | 558 | putative transporter; Provisional | 92.65 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 92.61 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 91.41 | |
| COG3263 | 574 | NhaP-type Na+/H+ and K+/H+ antiporters with a uniq | 90.66 | |
| COG0168 | 499 | TrkG Trk-type K+ transport systems, membrane compo | 90.35 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 90.3 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 89.84 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 89.66 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 89.4 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 89.29 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 88.95 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 88.38 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 88.31 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 87.85 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 87.69 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 87.11 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 86.89 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 86.57 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 86.26 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 86.04 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 85.97 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 85.91 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 85.64 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 85.62 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 85.53 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 85.31 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 84.99 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 84.92 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 84.87 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 84.86 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 84.26 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 84.18 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 84.03 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 84.02 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 83.96 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 83.95 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 83.93 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 83.89 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 83.66 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 83.49 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 83.46 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 83.39 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 83.29 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 83.22 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 83.14 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 83.03 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 82.97 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 82.96 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 82.47 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 82.29 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 82.11 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.02 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 82.01 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 81.87 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 81.71 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 81.65 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 81.58 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 81.51 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 81.45 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.4 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 81.36 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 81.27 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 81.15 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 81.08 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 81.01 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 80.87 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 80.86 | |
| PRK08643 | 256 | acetoin reductase; Validated | 80.64 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 80.51 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 80.49 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 80.48 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 80.3 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 80.19 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 80.17 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 80.06 |
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.5e-30 Score=284.58 Aligned_cols=232 Identities=20% Similarity=0.230 Sum_probs=188.1
Q ss_pred HHHHHHHHHHHHhhhhhccC------CCHHHHHHHHHHhhhccCCCC-ccCCCCCeEEeeeehhhhHHHHHHHHHHHHH-
Q 005788 292 LFATIFLIIFGGLALYAVSD------SSFAEALWLSWTFVADSGNHA-DRVGTGPRIVSVSISSGGMLIFAMMLGLVSD- 363 (677)
Q Consensus 292 l~~~l~lil~g~l~~~~iE~------~s~~dAlw~t~vTiTTvGyg~-~p~t~~gRi~~v~lil~Gi~ifa~lig~it~- 363 (677)
++++..++++|+++++++++ .++.|||||+++|+||+|||+ .|.+..||+|+++++++|+++|++.++.++.
T Consensus 141 ~~~~~~l~~~~~~g~~~~~~~f~~~~~s~~dA~y~svvt~tTvGyGdi~p~t~~grl~~i~~ii~Gi~vf~~~is~i~~p 220 (393)
T PRK10537 141 VISITSLLFYSTFGALYLGDGFSPPIESLSTAFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFATSISAIFGP 220 (393)
T ss_pred HHHHHHHHHHHHHHHHHHccccCcCCCCHHHHHHhhheeeecccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33444566677777777764 699999999999999999996 4888899999999999999999998887765
Q ss_pred HHHHhhhhhccCc-cceeecCeEEEEeccchHHHHHHHHHHhcccCCCCeEEEEEcCChHHHHHHHHhhhcccCCccEEE
Q 005788 364 AISEKVDSLRKGK-SEVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVIC 442 (677)
Q Consensus 364 ~i~~~i~~lr~G~-~~v~~knHIII~G~g~~g~~Ll~eL~~~~~s~~~~~iVVLiD~d~e~~e~~l~~~~~~~~~~~V~~ 442 (677)
.+.+++++..+++ .....+||+||||||+.+..++++|.+.+ .+++++|+|+. ++.. ..++.+
T Consensus 221 ~i~~~l~~~~~~~~~~~~~k~HvII~G~g~lg~~v~~~L~~~g------~~vvVId~d~~--~~~~--------~~g~~v 284 (393)
T PRK10537 221 VIRGNLKRLVKGRISHMHRKDHFIICGHSPLAINTYLGLRQRG------QAVTVIVPLGL--EHRL--------PDDADL 284 (393)
T ss_pred HHHHHHHHHHHhhhhhcccCCeEEEECCChHHHHHHHHHHHCC------CCEEEEECchh--hhhc--------cCCCcE
Confidence 4555554433333 22345899999999999999999997653 57888887642 2221 235678
Q ss_pred EEeCCCCHHHHhccCcccccEEEEecCCCCCccchHHHHHHHHHHhhhcCCCCceEEEEeCCCCCHHHHHHcCCCeeEEE
Q 005788 443 RSGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETV 522 (677)
Q Consensus 443 I~Gd~~~~e~L~rA~I~~A~aVIIltdd~~~~~sDa~NI~i~Lsar~l~p~l~~~IIArv~d~e~~~~l~~aGad~VevV 522 (677)
+.||++++++|++||+++|+++|++++ +|++|+.+++++|+++| +++|||++.|+++.++++.+|+| .+|
T Consensus 285 I~GD~td~e~L~~AgI~~A~aVI~~t~------dD~~Nl~ivL~ar~l~p--~~kIIa~v~~~~~~~~L~~~GaD--~VI 354 (393)
T PRK10537 285 IPGDSSDSAVLKKAGAARARAILALRD------NDADNAFVVLAAKEMSS--DVKTVAAVNDSKNLEKIKRVHPD--MIF 354 (393)
T ss_pred EEeCCCCHHHHHhcCcccCCEEEEcCC------ChHHHHHHHHHHHHhCC--CCcEEEEECCHHHHHHHHhcCCC--EEE
Confidence 999999999999999999999999996 49999999999999998 67999999999999999999999 458
Q ss_pred echHHHHHHHHHHhcCCcH-HHHHHHHh
Q 005788 523 VAHDVIGRLMIQCALQPGL-AQIWEDIL 549 (677)
Q Consensus 523 v~~el~a~lLaq~a~~Pgl-~~Vl~~Ll 549 (677)
++.++.++.|++.+..+.+ .+.+++++
T Consensus 355 sp~~l~g~~la~~l~g~~I~~~~i~~~~ 382 (393)
T PRK10537 355 SPQLLGSELLARTLNGEEIDNDMITSML 382 (393)
T ss_pred CHHHHHHHHHHHHhcCCCCCHHHHHHHH
Confidence 8888899999999987655 34555554
|
|
| >PF06241 DUF1012: Protein of unknown function (DUF1012); InterPro: IPR010420 This entry represents the CASTOR/POLLUX/SYM8 family of ion channels, which are found in plants | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0490 Putative regulatory, ligand-binding protein related to C-terminal domains of K+ channels [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >COG3400 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02080 TrkA_C: TrkA-C domain; InterPro: IPR006037 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3273 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03493 BK_channel_a: Calcium-activated BK potassium channel alpha subunit; InterPro: IPR003929 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >PRK05326 potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK03818 putative transporter; Validated | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK04972 putative transporter; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0168 TrkG Trk-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 677 | ||||
| 3rbz_A | 340 | Mthk Channel, Ca2+-Bound Length = 340 | 7e-06 | ||
| 3rbx_A | 234 | Mthk Rck Domain D184n Mutant, Ca2+-Bound Length = 2 | 9e-06 | ||
| 1lnq_A | 336 | Crystal Structure Of Mthk At 3.3 A Length = 336 | 1e-05 | ||
| 2fy8_A | 230 | Crystal Structure Of Mthk Rck Domain In Its Ligand- | 1e-05 | ||
| 4ei2_A | 242 | Crystal Structures Of Mthk Rck Gating Ring Bound To | 1e-05 | ||
| 2aef_A | 234 | Crystal Structures Of The Mthk Rck Domain In Ca2+ B | 1e-05 | ||
| 2ogu_A | 233 | Crystal Structure Of The Isolated Mthk Rck Domain L | 1e-05 | ||
| 3kxd_A | 224 | Crystal Structure Of The Mthk Rck In Complex With C | 3e-05 |
| >pdb|3RBZ|A Chain A, Mthk Channel, Ca2+-Bound Length = 340 | Back alignment and structure |
|
| >pdb|3RBX|A Chain A, Mthk Rck Domain D184n Mutant, Ca2+-Bound Length = 234 | Back alignment and structure |
| >pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 | Back alignment and structure |
| >pdb|2FY8|A Chain A, Crystal Structure Of Mthk Rck Domain In Its Ligand-Free Gating-Ring Form Length = 230 | Back alignment and structure |
| >pdb|4EI2|A Chain A, Crystal Structures Of Mthk Rck Gating Ring Bound To Barium Length = 242 | Back alignment and structure |
| >pdb|2AEF|A Chain A, Crystal Structures Of The Mthk Rck Domain In Ca2+ Bound Form Length = 234 | Back alignment and structure |
| >pdb|2OGU|A Chain A, Crystal Structure Of The Isolated Mthk Rck Domain Length = 233 | Back alignment and structure |
| >pdb|3KXD|A Chain A, Crystal Structure Of The Mthk Rck In Complex With Cadmium Length = 224 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 677 | |||
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 3e-48 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 4e-43 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 6e-37 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 3e-04 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 4e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 7e-08 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 5e-05 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 4e-04 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 5e-04 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 6e-04 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 7e-04 |
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
Score = 171 bits (436), Expect = 3e-48
Identities = 68/341 (19%), Positives = 145/341 (42%), Gaps = 41/341 (12%)
Query: 286 AKLLALLFATIFLIIFGGLALYAVSDSSFAEALWLSWTFVADS----GNHADRVGTGPRI 341
+L + +II+G + + S+ +L+ WTFV + G+++ G
Sbjct: 18 VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLY--WTFVTIATVGYGDYSPSTPLG-MY 74
Query: 342 VSVSISSGGMLIFAMMLGLVSDAISEKVDSLRKGKSEVIEKNHILILGWSDKLGSLLKQL 401
+V++ G+ FA+ + + + + + G +V + H++I GWS+ L++L
Sbjct: 75 FTVTLIVLGIGTFAVAVERLLEFLINREQMKLMGLIDVAKSRHVVICGWSESTLECLREL 134
Query: 402 AVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPLILADLKKVSVSKA 461
G V V+ + + + + G + + G P ++DL+K +V A
Sbjct: 135 R------GSEVFVLAEDENVRK--------KVLRSGANFV--HGDPTRVSDLEKANVRGA 178
Query: 462 RAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIET 521
RA+IV D+ + +L + + E + ++ E +N +++ G + +
Sbjct: 179 RAVIVDLES------DSETIHCILGIRKIDESV--RIIAEAERYENIEQLRMAGAD--QV 228
Query: 522 VVAHDVIGRLMIQCALQPGLAQIWEDILGFEN----AEFYIKRWPQLDDLRFEEVVI-SF 576
+ + GRLM + A +D+L E+ E I +L+ + + I
Sbjct: 229 ISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIHDV 288
Query: 577 PDAIPCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIAEDDD 617
I G+ G ++I++P +Y + GD +L I + ++
Sbjct: 289 TGVIIIGVG---RGDELIIDPPRDYSFRAGDIILGIGKPEE 326
|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} Length = 798 | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726 | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A Length = 726 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 677 | |||
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 100.0 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 100.0 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 99.97 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 99.96 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 99.96 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 99.94 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 99.92 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 99.91 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.89 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 99.85 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 99.73 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 99.67 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 99.59 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 99.56 | |
| 4hpf_A | 722 | Potassium channel subfamily U member 1; PH-gated, | 99.42 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 99.37 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 99.32 | |
| 3naf_A | 798 | Calcium-activated potassium channel subunit alpha; | 99.24 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.23 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.22 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.21 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.2 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 99.19 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.19 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 99.19 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.18 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.16 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.15 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.15 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.13 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.12 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.09 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.05 | |
| 3mt5_A | 726 | Potassium large conductance calcium-activated CHA | 99.02 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.02 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.97 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 98.93 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 98.75 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 98.72 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 98.5 | |
| 1vct_A | 205 | Hypothetical protein PH0236; helix rich, structura | 98.48 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.47 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.4 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 98.27 | |
| 3jxo_A | 86 | TRKA-N domain protein; TRKA K+ channel component, | 98.15 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.57 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.8 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 95.34 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 95.28 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.81 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 93.61 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.53 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 92.82 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 92.77 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 92.09 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 91.7 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 91.51 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 90.83 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 90.61 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 90.27 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 90.0 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 89.91 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 89.88 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 89.87 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 89.47 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 89.22 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 89.16 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 89.05 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 88.93 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 88.56 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 88.56 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 88.38 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 88.02 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 87.97 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 87.76 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 87.6 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 87.44 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 87.36 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 87.36 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 87.34 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 87.32 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 87.29 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 87.18 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 87.18 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 87.16 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 87.09 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 87.07 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 86.99 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 86.98 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 86.7 | |
| 3pjz_A | 494 | Potassium uptake protein TRKH; structural genomics | 86.65 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 86.55 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 86.52 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 86.47 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 86.35 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 85.98 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 85.94 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 85.83 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 85.76 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 85.62 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 85.61 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 85.57 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 85.44 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 85.31 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 85.24 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 85.17 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 85.15 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 85.11 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 84.97 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 84.83 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 84.78 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 84.75 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 84.64 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 84.6 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 84.58 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 84.57 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 84.56 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 84.55 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 84.52 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 84.33 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 84.3 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 84.25 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 84.24 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 84.12 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 84.1 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 83.98 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 83.95 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 83.88 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 83.79 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 83.75 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 83.73 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 83.67 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 83.6 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 83.55 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 83.52 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 83.51 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 83.5 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 83.49 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 83.41 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 83.39 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 83.37 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 83.35 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 83.35 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 83.3 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 83.14 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 83.09 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 82.92 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 82.7 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 82.66 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 82.63 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 82.46 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 82.44 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 82.37 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 82.37 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 82.31 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 82.31 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 82.23 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 82.23 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 82.07 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 81.94 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 81.72 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 81.52 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 81.48 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 81.47 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 81.43 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 81.4 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 81.23 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 81.2 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 81.07 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 81.05 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 81.02 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 81.02 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 80.93 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 80.9 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 80.78 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 80.65 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 80.61 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 80.6 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 80.51 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 80.41 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 80.37 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 80.32 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 80.28 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 80.25 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 80.14 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 80.09 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 80.01 |
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-43 Score=402.51 Aligned_cols=350 Identities=16% Similarity=0.168 Sum_probs=214.2
Q ss_pred hhheeeccccchHHHHHHHHHHHHHHHHHHHhhhhh----ccC--CCHHHHHHHHHHhhhccCCCCc-cCCCCCeEEeee
Q 005788 273 AYSVDVCFSVYPYAKLLALLFATIFLIIFGGLALYA----VSD--SSFAEALWLSWTFVADSGNHAD-RVGTGPRIVSVS 345 (677)
Q Consensus 273 ~Y~ld~~~s~~~~~~l~~Ll~~~l~lil~g~l~~~~----iE~--~s~~dAlw~t~vTiTTvGyg~~-p~t~~gRi~~v~ 345 (677)
.|.+.+. ....+++++.+++++++++++++++|++ .|+ ++|+|||||+++|+||+|||+. |.+..||+|+++
T Consensus 6 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~y~~~~t~tTvGygd~~p~~~~~~~~~~~ 84 (565)
T 4gx0_A 6 AYFLRGR-ARQNLKVLLLYCAFLLVMLLAYASIFRYLMWHLEGRAYSFMAGIYWTITVMTTLGFGDITFESDAGYLFASI 84 (565)
T ss_dssp ----------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHH
T ss_pred ceeeech-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCchhhhhheeeeeeeeecCCCcCCCCccHHHHHHH
Confidence 3444333 4456667777777777777788877766 566 8999999999999999999975 788889999999
Q ss_pred ehhhhHHHHHHHHHH-HHHHHHHh-----hhhhccCccceeecCeEEEEeccchHHHHHHHHHHhcccCCCCeEEEEEcC
Q 005788 346 ISSGGMLIFAMMLGL-VSDAISEK-----VDSLRKGKSEVIEKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAER 419 (677)
Q Consensus 346 lil~Gi~ifa~lig~-it~~i~~~-----i~~lr~G~~~v~~knHIII~G~g~~g~~Ll~eL~~~~~s~~~~~iVVLiD~ 419 (677)
++++|++++++.++. +++.+... ++..+.++.....++|+||||||+.|..++++|...+ ++|+++|.
T Consensus 85 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hviI~G~g~~g~~la~~L~~~~------~~vvvid~ 158 (565)
T 4gx0_A 85 VTVSGVIFLDIILPFGFVSMFLAPWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESRN------HLFVVVTD 158 (565)
T ss_dssp HHHHHHHHHHTHHHHHHHHHHHHHHHHHHTSCCCBCCCCTTCCSCEEEESCCHHHHHHHHHTTTTT------CCEEEEES
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccCCeEEEECCChHHHHHHHHHHHCC------CCEEEEEC
Confidence 999999999988887 44443332 2222333343567999999999999999999998764 78999999
Q ss_pred ChHHHHHHHHhhhcccCCccEEEEEeCCCCHHHHhccCcccccEEEEecCCCCCccchHHHHHHHHHHhhhcCCCCceEE
Q 005788 420 DKEEMEMDIAKLEFDFMGTSVICRSGSPLILADLKKVSVSKARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVV 499 (677)
Q Consensus 420 d~e~~e~~l~~~~~~~~~~~V~~I~Gd~~~~e~L~rA~I~~A~aVIIltdd~~~~~sDa~NI~i~Lsar~l~p~l~~~II 499 (677)
|++.++++.++ .++.++.||++++++|++|++++|+++|+ +. +|+.|+.+|+++|+++ +.+||
T Consensus 159 ~~~~~~~~~~~-------~~~~~i~Gd~~~~~~L~~a~i~~a~~vi~-t~------~D~~n~~~~~~ar~~~---~~~ii 221 (565)
T 4gx0_A 159 NYDQALHLEEQ-------EGFKVVYGSPTDAHVLAGLRVAAARSIIA-NL------SDPDNANLCLTVRSLC---QTPII 221 (565)
T ss_dssp CHHHHHHHHHS-------CSSEEEESCTTCHHHHHHTTGGGCSEEEE-CS------CHHHHHHHHHHHHTTC---CCCEE
T ss_pred CHHHHHHHHHh-------cCCeEEEeCCCCHHHHHhcCcccCCEEEE-eC------CcHHHHHHHHHHHHhc---CceEE
Confidence 99988776431 26789999999999999999999999998 53 4889999999999998 46899
Q ss_pred EEeCCCCCHHHHHHcCCCeeEEEechHHHHHHHHHHhcCCcHH-HHHHHHhcCCCceEEEecCCCCCCCcHHhHhhhC-C
Q 005788 500 VEMSDLDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPGLA-QIWEDILGFENAEFYIKRWPQLDDLRFEEVVISF-P 577 (677)
Q Consensus 500 Arv~d~e~~~~l~~aGad~VevVv~~el~a~lLaq~a~~Pgl~-~Vl~~Ll~~~g~ei~i~~~p~lvGktf~el~~~~-~ 577 (677)
|++.++++.+.++.+|+| .+|++.+..++.|++.+..|+.. +++...-+....|+.+. .++++|++++|+..+. .
T Consensus 222 ar~~~~~~~~~l~~~Gad--~vi~p~~~~~~~la~~~~~p~~~~~~~~~~~~~~l~e~~v~-~s~l~G~~l~el~~~~~~ 298 (565)
T 4gx0_A 222 AVVKEPVHGELLRLAGAN--QVVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELPVH-GTPFAGKTIGESGIRQRT 298 (565)
T ss_dssp EECSSGGGHHHHHHHTCS--EEECHHHHHHHHHHHHHHC-----------------------------------------
T ss_pred EEECCHHHHHHHHHcCCC--EEEChHHHHHHHHHHHhcccccccchhcccCCceEEEEEEC-CCccCCCCHHHcCcchhc
Confidence 999999999999999999 45888889999999999999985 43332111123566677 7899999999987543 3
Q ss_pred CeEEEEEEEeecCCeEEeCCCCCceecCCCEEEEEEeCCCCCCCCCCCccccccccCCCCCCCCCceEEEEccccCHHHH
Q 005788 578 DAIPCGIKVAAEGGKIILNPDDNYVLKEGDEVLVIAEDDDTYAPGPLPEVCKRSFLKIPDPPKYPEKILFCGWRRDIDDM 657 (677)
Q Consensus 578 ~aiVIGI~r~~~~G~~ilnP~~d~vI~~GD~LiVIg~~~di~~~~~~~~v~~~~~~~~~~~~~~~~rVLI~Gwgr~~~~~ 657 (677)
++.++||+| +|+.+ +|+++++|++||.|+++|+.+++.++..... ...+. ++++|||||+.|..+
T Consensus 299 ~~~vi~i~r---~g~~~-~p~~~~~l~~GD~L~v~g~~~~l~~~~~~~~----------~~~~~-~~viIiG~G~~G~~l 363 (565)
T 4gx0_A 299 GLSIIGVWE---RGSLT-TPQRETVLTEQSLLVLAGTKSQLAALEYLIG----------EAPED-ELIFIIGHGRIGCAA 363 (565)
T ss_dssp --------------------------------------------------------------CC-CCEEEECCSHHHHHH
T ss_pred CCEEEEEEE---CCEEe-CCCCCcEeCCCCEEEEEeCHHHHHHHHHHhc----------CCCCC-CCEEEECCCHHHHHH
Confidence 799999998 56666 9999999999999999999999998876522 12223 899999999999999
Q ss_pred HHHHHhh
Q 005788 658 IMVIFLQ 664 (677)
Q Consensus 658 i~~Ld~~ 664 (677)
+++|.+.
T Consensus 364 a~~L~~~ 370 (565)
T 4gx0_A 364 AAFLDRK 370 (565)
T ss_dssp HHHHHHT
T ss_pred HHHHHHC
Confidence 9999753
|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >4hpf_A Potassium channel subfamily U member 1; PH-gated, membrane protein, transport Pro; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3naf_A Calcium-activated potassium channel subunit alpha; ION channel, gating ring, rossman fold, transport, ION trans; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3mt5_A Potassium large conductance calcium-activated CHA subfamily M, alpha member 1; potassium channel, membrane protein, transport protein; 3.00A {Homo sapiens} PDB: 3u6n_A | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1vct_A Hypothetical protein PH0236; helix rich, structural genomics, riken structural genomics/P initiative, RSGI, NPPSFA; 1.85A {Pyrococcus horikoshii} SCOP: a.7.12.1 d.286.1.1 PDB: 2bkn_A 2bko_A 2bkp_A | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxo_A TRKA-N domain protein; TRKA K+ channel component, structural genomics, PSI-2-2, Pro structure initiative, joint center for structural genomics; 1.55A {Thermotoga SP} | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3pjz_A Potassium uptake protein TRKH; structural genomics, PSI-2, protein structure initiative, NE consortium on membrane protein structure; 3.51A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 677 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-06 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 7e-06 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 1e-04 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 1e-04 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 43.9 bits (104), Expect = 2e-06
Identities = 13/77 (16%), Positives = 37/77 (48%), Gaps = 3/77 (3%)
Query: 291 LLFATIFLIIFGGLALYAVSDSSFAEALWLSWTFVADSGNHADRVGTGP--RIVSVSISS 348
+L + +II+G + + S+ +L+ ++ +A + + D + P +V++
Sbjct: 5 ILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIA-TVGYGDYSPSTPLGMYFTVTLIV 63
Query: 349 GGMLIFAMMLGLVSDAI 365
G+ FA+ + + + +
Sbjct: 64 LGIGTFAVAVERLLEFL 80
|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 677 | |||
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 99.85 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 99.81 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 99.74 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 99.65 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.31 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 98.99 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 98.86 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 98.77 | |
| d2fy8a2 | 92 | Potassium channel-related protein MthK, C-terminal | 98.4 | |
| d1vcta2 | 94 | Hypothetical protein PH0236, C-terminal domain {Py | 98.27 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.27 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.48 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 95.47 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 94.99 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 93.09 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 92.73 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.31 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 91.96 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 91.42 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 90.94 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 89.84 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 89.75 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 89.7 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 89.68 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 89.67 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 89.12 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 89.11 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 89.11 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 89.08 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.85 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 88.66 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 88.66 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 87.94 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 87.89 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 87.7 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 87.64 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 87.62 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 87.53 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 87.42 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 87.32 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 87.13 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 87.1 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 86.92 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 86.88 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 86.73 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 86.57 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 86.41 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 86.39 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 86.25 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 86.24 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 86.19 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 86.13 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 86.12 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 86.05 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 85.99 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 85.98 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 85.58 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 85.5 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 85.4 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 85.16 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 84.91 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 84.29 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 84.23 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 83.97 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 83.92 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 83.52 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 82.81 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 82.72 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 82.39 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 81.94 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 81.55 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 81.47 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 81.15 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 80.58 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 80.53 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 80.35 |
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Potassium channel NAD-binding domain domain: Rck domain from putative potassium channel Kch species: Escherichia coli [TaxId: 562]
Probab=99.85 E-value=2.1e-21 Score=182.02 Aligned_cols=143 Identities=20% Similarity=0.190 Sum_probs=124.2
Q ss_pred ecCeEEEEeccchHHHHHHHHHHhcccCCCCeEEEEEcCChHHHHHHHHhhhcccCCccEEEEEeCCCCHHHHhccCccc
Q 005788 381 EKNHILILGWSDKLGSLLKQLAVANKSIGGGVIVVLAERDKEEMEMDIAKLEFDFMGTSVICRSGSPLILADLKKVSVSK 460 (677)
Q Consensus 381 ~knHIII~G~g~~g~~Ll~eL~~~~~s~~~~~iVVLiD~d~e~~e~~l~~~~~~~~~~~V~~I~Gd~~~~e~L~rA~I~~ 460 (677)
.+|||||||||+.|..++++|...+ ..|+++|.|++......++.. ..++.++.||++++++|++|++++
T Consensus 2 ~knHiII~G~g~~g~~l~~~L~~~~------~~v~vId~d~~~~~~~~~~~~----~~~~~vi~Gd~~d~~~L~~a~i~~ 71 (153)
T d1id1a_ 2 RKDHFIVCGHSILAINTILQLNQRG------QNVTVISNLPEDDIKQLEQRL----GDNADVIPGDSNDSSVLKKAGIDR 71 (153)
T ss_dssp CCSCEEEECCSHHHHHHHHHHHHTT------CCEEEEECCCHHHHHHHHHHH----CTTCEEEESCTTSHHHHHHHTTTT
T ss_pred CCCEEEEECCCHHHHHHHHHHHHcC------CCEEEEeccchhHHHHHHHhh----cCCcEEEEccCcchHHHHHhcccc
Confidence 4799999999999999999998764 678888888865544444321 347889999999999999999999
Q ss_pred ccEEEEecCCCCCccchHHHHHHHHHHhhhcCCCCceEEEEeCCCCCHHHHHHcCCCeeEEEechHHHHHHHHHHhcCCc
Q 005788 461 ARAIIVLASDENADQSDARALRVVLSLTGVKEGLRGHVVVEMSDLDNEPLVKLVGGELIETVVAHDVIGRLMIQCALQPG 540 (677)
Q Consensus 461 A~aVIIltdd~~~~~sDa~NI~i~Lsar~l~p~l~~~IIArv~d~e~~~~l~~aGad~VevVv~~el~a~lLaq~a~~Pg 540 (677)
|+++|++++ +|+.|+.+++++|+++| ..+|||++.++++.+.++.+|+| .+|.+.++.|+.|++.+..|+
T Consensus 72 a~~vi~~~~------~d~~n~~~~~~~r~~~~--~~~iia~~~~~~~~~~l~~~Gad--~vi~p~~~~~~~l~~~l~~~~ 141 (153)
T d1id1a_ 72 CRAILALSD------NDADNAFVVLSAKDMSS--DVKTVLAVSDSKNLNKIKMVHPD--IILSPQLFGSEILARVLNGEE 141 (153)
T ss_dssp CSEEEECSS------CHHHHHHHHHHHHHHTS--SSCEEEECSSGGGHHHHHTTCCS--EEECHHHHHHHHHHHHHTTCC
T ss_pred CCEEEEccc------cHHHHHHHHHHHHHhCC--CCceEEEEcCHHHHHHHHHCCCC--EEECHHHHHHHHHHHHhCcCC
Confidence 999999996 49999999999999998 67899999999999999999999 457777788999999999998
Q ss_pred HHH
Q 005788 541 LAQ 543 (677)
Q Consensus 541 l~~ 543 (677)
+.+
T Consensus 142 v~~ 144 (153)
T d1id1a_ 142 INN 144 (153)
T ss_dssp CCH
T ss_pred CCH
Confidence 854
|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2fy8a2 d.286.1.1 (A:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vcta2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|