Citrus Sinensis ID: 005807

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------

MAIAGILRSLRRRDVASAHLSACKSLTGNVKPSWASANWASLARPFSARPAGNDVIGVDLGTTNSCVAVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPANTLFGTKRLIGRRFNDAQTQKEMKMVPFKIVNAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSEAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGMNNKEGLIAVFDLGGGTFDVSVLEISNGVFEVKATNGDTFLGGEDFDNALLEFLVSEFKRTERIDLSQDKLALQRLRESAEKAKIELSSTSQTEINLPFITADASGAKHLNITLTRSKFETLVNHLIERTKAPCKNCLKDANITIKDVDEVLLVGGMTRVPKVQEIVTEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMAADNKALGEFELMGIPPAPRGIPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSESEIEKMVKEAELHAQRDQERKTLIDIRNNADTTIYSIEKSLGEYREKIPGEVAKEIEDAVSDLRKAMAGEDIDGIKAKLDAANKAVSKIGQHMAGGSSDNSASGGSQGGDQAPEAEYEEVKK

cHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEccccEECcccccccccccCEEEcccccEEEcccccccccccccccHHHHHHccccccccHHHHHHHccccCEEEEcccccEEEECccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccEECccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccEEEEECcccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccEEcccccccccccccEEEEEEcccccCEEEEEccccccccEEEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcc

**************VASAHLSACKSLTGNVKPSWASANWASLARPFSARPAGNDVIGVDLGTTNSCVAVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPANTLFGTKRLIGRRFNDAQTQKEMKMVPFKIVNAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSEAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGMNNKEGLIAVFDLGGGTFDVSVLEISNGVFEVKATNGDTFLGGEDFDNALLEFLVSEFKRTERIDLSQDKLALQRLRESAEKAKIELSSTSQTEINLPFITADASGAKHLNITLTRSKFETLVNHLIERTKAPCKNCLKDANITIKDVDEVLLVGGMTRVPKVQEIVTEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMAADNKALGEFELMGIPPAPRGIPQIEVTFDIDANGIVTVSAKDKATGKE**************EIEKMVKEAE**********TLIDIRNNADTTIYSIEKSLGEY***********IEDAVSD****************LDAANKA*************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAIAGILRSLRRRDVASAHLSACKSLTGNVKPSWASANWASLARPFSARPAGNDVIGVDLGTTNSCVAVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPANTLFGTKRLIGRRFNDAQTQKEMKMVPFKIVNAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSEAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGMNNKEGLIAVFDLGGGTFDVSVLEISNGVFEVKATNGDTFLGGEDFDNALLEFLVSEFKRTERIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxEINLPFITADASGAKHLNITLTRSKFETLVNHLIERTKAPCKNCLKDANITIKDVDEVLLVGGMTRVPKVQEIVTEIFGKSPSKGVNPDEAVALGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMAADNKALGEFELMGIPPAPRGIPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSESEIEKMVKEAELHAQRDQERKTLIDIRNNADTTIYSIEKSLGEYREKIPGEVAKEIEDAVSDLRKAMAGEDIDGIKAKLDAANKAVSKIGQHMAGGSSDNSASGGSQGGDQAPEAEYEEVKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heat shock 70 kDa protein 10, mitochondrial	In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.	confident	Q9LDZ0
Chaperone protein DnaK	Acts as a chaperone.	probable	Q1MN11
Chaperone protein DnaK	Acts as a chaperone.	probable	Q98DD1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KHO, chain A
Confidence level:very confident
Coverage over the Query: 55-648
View the alignment between query and template
View the model in PyMOL

Template: 2P32, chain A
Confidence level:confident
Coverage over the Query: 574-650
View the alignment between query and template
View the model in PyMOL