Citrus Sinensis ID: 005818

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK
ccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEECcccccHHHHHHHHHHccccEEEEccccccccccccccHHHHHcccHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccHHccccHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHcccccccccEEccccccccccccccccHHHHccccccccHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccHHHHcccccccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccEEEEccccccccccccccccccccEEccHHHHHHHHHHHHHHccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHccccccccccccHHHHccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccHHHHEEEEEcccccccccHHHHHHHccccccHHHHHHHHHcccccccccccccc
****YTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPR********************************************FLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVA**************EFPELLSIKESLIKNVFEPNKKP*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable rhamnose biosynthetic enzyme 1 Probably involved in the synthesis of pectinaceous rhamnogalacturonan I.confidentQ9SYM5
Probable rhamnose biosynthetic enzyme 2 Involved in the synthesis of pectinaceous rhamnogalacturonan I, the major component of Arabidopsis mucilage. Required for the normal seed coat epidermal development.probableQ9LPG6
Probable rhamnose biosynthetic enzyme 3 Probably involved in the synthesis of pectinaceous rhamnogalacturonan I.probableQ9LH76

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HUN, chain A
Confidence level:very confident
Coverage over the Query: 7-339
View the alignment between query and template
View the model in PyMOL
Template: 1T2A, chain A
Confidence level:very confident
Coverage over the Query: 385-667
View the alignment between query and template
View the model in PyMOL