Citrus Sinensis ID: 005818

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK
ccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccHHccccHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHcccccccccEEccccccccccccccccHHHHccccccccHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccHHHHcccccccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHccccEEEEccccccccccccccccccccEEccHHHHHHHHHHHHHHccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHccccccccccccHHHHccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccHHHHEEEEEcccccccccHHHHHHHccccccHHHHHHHHHcccccccccccccc
ccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHcccccccccEEEEccccccHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHcHHHHHHHHHHHHcccEEEEEEEEEHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcEEEccccccccHHHHHHHHHHccccEEEEcccccEEEEEEHHHHHHHHHHHHHHcccccEEEEccccEEEHHHHHHHHHHHHccccHHcEEEEccccccccEEEEcHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHccccccHHHcccccccccccccccccccccccccccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEcEccccHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccHEEEEEcccEEEccccHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccccccEEEcHHHHcEEEEcccccccccHHHHHHHcHHHccHHHHHHHHHcccccccccccccc
matvytpknilITGAAGFIASHVCNRlignypeyKIVVLDKLdycsnlknlnpsrlspnfkfikgdvasADLVHFILLTEKIDTIMHFAAQthvdnsfgnsfeftknniygTHVLLEACKITGQIKRFIHVStdevygetdedavvgnheasqllptnpysatkAGAEMLVMAYGrsyglpvittrgnnvygpnqfpeklIPKFILLAmkgkplpihgdgsnvrsyLYCEDVAEAFDTIlhkgevghvynigtkkerrVIDVATDICklfslnpdtqikfvenrpfndqryFLDVQKlkqlgwyerVTWEEGLQKTMKWYisnpdwwgdvsgallphprtsmapaiegkvdghdTTFMLKINNSSQSRMVVRASksnssrqkpFLKFLIYGRTGWIGGLLSKIcekkgipfeygkgrleNRSQLLADIqnvkpthvfnaagvtgrpnvdwcethkpetirtnVVGTLTLADVCRENGLLMMNYATGcifeydakhpegtgigfkeedkpnftgsfySKTKAMVEELLKEYDNVCtlrvrmpissdlnnprnfitKISRYNkvvnipnsmtilDELLPISVEMAKRNLsgiwnftnpgvvsHNEILEMYKAyidpgfkwtnftlEEQAKVivaprsnneldasklkkEFPELLSIKESLIknvfepnkkptfggvak
matvytpkniLITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGnheasqllptnpYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILhkgevghvynigtkkerrvIDVATDICKLfslnpdtqikfvenrpfndQRYFLDVqklkqlgwYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKinnssqsrMVVRasksnssrqkpfLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVfnaagvtgrpnvdwcethkpetirtnvvgtLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTgigfkeedkpnfTGSFYSKTKAMVEELLKEYDNVCTLRvrmpissdlnnprnfITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVaprsnneldasklKKEFPELLSIKEsliknvfepnkkptfggvak
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK
***VYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNH****LLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPH*******************FM*************************FLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKE***PNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVA*************************LI*****************
*****TP**ILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPR**********************************************KFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIV***************EFPELLSIKESLIKNVFEPNKKP*******
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSS***************QKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK
****YTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAI******************SQSRMVVRASKS*S**QKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNK*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFEPNKKPTFGGVAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query676 2.2.26 [Sep-21-2011]
Q9SYM5669 Probable rhamnose biosynt yes no 0.982 0.992 0.840 0.0
Q9LH76664 Probable rhamnose biosynt no no 0.980 0.998 0.823 0.0
Q9LPG6667 Probable rhamnose biosynt no no 0.980 0.994 0.815 0.0
Q8VDR7355 dTDP-D-glucose 4,6-dehydr yes no 0.483 0.921 0.479 3e-87
Q54WS6434 dTDP-D-glucose 4,6-dehydr yes no 0.467 0.728 0.469 1e-85
O95455350 dTDP-D-glucose 4,6-dehydr yes no 0.483 0.934 0.470 6e-85
A6QLW2355 dTDP-D-glucose 4,6-dehydr yes no 0.483 0.921 0.467 1e-84
Q5UR12323 Putative dTDP-D-glucose 4 N/A no 0.460 0.962 0.466 1e-76
P37777361 dTDP-glucose 4,6-dehydrat no no 0.467 0.875 0.415 4e-66
P27830355 dTDP-glucose 4,6-dehydrat N/A no 0.471 0.898 0.415 1e-65
>sp|Q9SYM5|RHM1_ARATH Probable rhamnose biosynthetic enzyme 1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/665 (84%), Positives = 606/665 (91%), Gaps = 1/665 (0%)

Query: 5   YTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIK 64
           YTPKNILITGAAGFIASHV NRLI +YP+YKIVVLDKLDYCSNLKNLNPS+ SPNFKF+K
Sbjct: 4   YTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFVK 63

Query: 65  GDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQ 124
           GD+ASADLV+ +L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+TGQ
Sbjct: 64  GDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ 123

Query: 125 IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT 184
           I+RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct: 124 IRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT 183

Query: 185 TRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGE 244
           TRGNNVYGPNQFPEKLIPKFILLAM+G+ LPIHGDGSNVRSYLYCEDVAEAF+ +LHKGE
Sbjct: 184 TRGNNVYGPNQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYLYCEDVAEAFEVVLHKGE 243

Query: 245 VGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWY 304
           VGHVYNIGTKKERRV DVA DICKLF+++P+  IKFV+NRPFNDQRYFLD QKLK+LGW 
Sbjct: 244 VGHVYNIGTKKERRVNDVAKDICKLFNMDPEANIKFVDNRPFNDQRYFLDDQKLKKLGWS 303

Query: 305 ERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNS 364
           ER TWEEGL+KTM WY  NP+WWGDVSGALLPHPR  M P         D +    ++  
Sbjct: 304 ERTTWEEGLKKTMDWYTQNPEWWGDVSGALLPHPRMLMMPGGRHFDGSEDNSLAATLSEK 363

Query: 365 -SQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQ 423
            SQ+ MVV + +SN + QKP LKFLIYG+TGWIGGLL KIC+K+GI +EYGKGRLE+RS 
Sbjct: 364 PSQTHMVVPSQRSNGTPQKPSLKFLIYGKTGWIGGLLGKICDKQGIAYEYGKGRLEDRSS 423

Query: 424 LLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNY 483
           LL DIQ+VKPTHVFN+AGVTGRPNVDWCE+HK ETIR NV GTLTLADVCRE+GLLMMN+
Sbjct: 424 LLQDIQSVKPTHVFNSAGVTGRPNVDWCESHKTETIRANVAGTLTLADVCREHGLLMMNF 483

Query: 484 ATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPIS 543
           ATGCIFEYD KHPEG+GIGFKEED PNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPIS
Sbjct: 484 ATGCIFEYDDKHPEGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPIS 543

Query: 544 SDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNE 603
           SDLNNPRNFITKISRYNKVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVVSHNE
Sbjct: 544 SDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNE 603

Query: 604 ILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVF 663
           ILEMY+ YI+P FKW NFTLEEQAKVIVAPRSNNE+DASKLKKEFPELLSIKESLIK  +
Sbjct: 604 ILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAY 663

Query: 664 EPNKK 668
            PNKK
Sbjct: 664 GPNKK 668
Probably involved in the synthesis of pectinaceous rhamnogalacturonan I.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q9LH76|RHM3_ARATH Probable rhamnose biosynthetic enzyme 3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LPG6|RHM2_ARATH Probable rhamnose biosynthetic enzyme 2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 Back     alignment and function description
>sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 Back     alignment and function description
>sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=2 SV=1 Back     alignment and function description
>sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 Back     alignment and function description
>sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 Back     alignment and function description
>sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 Back     alignment and function description
>sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
283488505681 rhamnose synthase [Gossypium hirsutum] 0.988 0.980 0.855 0.0
225461808675 PREDICTED: probable rhamnose biosyntheti 0.986 0.988 0.852 0.0
211906526667 rhamnose synthase [Gossypium hirsutum] 0.977 0.991 0.852 0.0
283488503667 rhamnose synthase [Gossypium hirsutum] 0.982 0.995 0.849 0.0
356549610669 PREDICTED: probable rhamnose biosyntheti 0.979 0.989 0.849 0.0
356544142669 PREDICTED: probable rhamnose biosyntheti 0.979 0.989 0.849 0.0
356525600668 PREDICTED: probable rhamnose biosyntheti 0.974 0.986 0.843 0.0
356556634668 PREDICTED: probable rhamnose biosyntheti 0.974 0.986 0.846 0.0
297839725669 RHM1/ROL1 [Arabidopsis lyrata subsp. lyr 0.982 0.992 0.848 0.0
357140549667 PREDICTED: probable rhamnose biosyntheti 0.980 0.994 0.839 0.0
>gi|283488505|gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information
 Score = 1206 bits (3120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/673 (85%), Positives = 617/673 (91%), Gaps = 5/673 (0%)

Query: 1   MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF 60
           MA  YTPKNILITGAAGFIASHVCNRLI NYP+YKIVVLDKLDYCS+LKNL+PSR SPNF
Sbjct: 1   MANKYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNF 60

Query: 61  KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK 120
           KFIKGD+ASADLVHFIL TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct: 61  KFIKGDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK 120

Query: 121 ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 180
           +TGQIKRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct: 121 VTGQIKRFIHVSTDEVYGETDEDAMVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 180

Query: 181 PVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTIL 240
           PVITTRGNNVYG NQFPEKLIPKFILLAM GK LPIHGDGSNVRSYLYCEDVAEAF+ IL
Sbjct: 181 PVITTRGNNVYGTNQFPEKLIPKFILLAMNGKILPIHGDGSNVRSYLYCEDVAEAFEVIL 240

Query: 241 HKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQ 300
           H+GEVGHVYNIGTKKERRVIDVA DIC+LF+L+P++QIKFVENRPFNDQRYFLD QKLK 
Sbjct: 241 HRGEVGHVYNIGTKKERRVIDVARDICRLFNLDPESQIKFVENRPFNDQRYFLDDQKLKS 300

Query: 301 LGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTT---- 356
           LGWYER TWEEGL+KTM+WY+SNPDWWGDVSGALLPHPR  M P IE + +  DT+    
Sbjct: 301 LGWYERTTWEEGLKKTMEWYVSNPDWWGDVSGALLPHPRMLMLPGIERQFNAPDTSNSGL 360

Query: 357 -FMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGK 415
                 N  +QSRM+V + K N   QKP LKFLIYGRTGWIGGLL K+CEK+GIPFEYGK
Sbjct: 361 GSAPVTNKFNQSRMLVPSPKHNIPSQKPSLKFLIYGRTGWIGGLLGKLCEKQGIPFEYGK 420

Query: 416 GRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRE 475
           GRLE RSQLL DIQ VKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLAD+CRE
Sbjct: 421 GRLEQRSQLLDDIQTVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADICRE 480

Query: 476 NGLLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCT 535
           + LLM+NYATGCIFEYDA HP GTG+GFKEEDKPNFTGSFYSKTKA+VEELL+E+DNVCT
Sbjct: 481 HDLLMINYATGCIFEYDATHPLGTGVGFKEEDKPNFTGSFYSKTKAVVEELLREFDNVCT 540

Query: 536 LRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTN 595
           LRVRMPISSDL+NPRNFITKI+RYNKVV+I NSMTILDELLP+S+EMAKRNL GIWNFTN
Sbjct: 541 LRVRMPISSDLSNPRNFITKITRYNKVVDISNSMTILDELLPVSIEMAKRNLRGIWNFTN 600

Query: 596 PGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIK 655
           PGVVSHNEIL+MYK YIDP F W NF+L+EQAKVIVAPRSNNELDASKLK EFPELLSIK
Sbjct: 601 PGVVSHNEILQMYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNELDASKLKNEFPELLSIK 660

Query: 656 ESLIKNVFEPNKK 668
           +SLIK VFEPN+K
Sbjct: 661 DSLIKYVFEPNRK 673

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461808|ref|XP_002285634.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|211906526|gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|283488503|gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|356549610|ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356544142|ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356525600|ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356556634|ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297839725|ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] gi|297333585|gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357140549|ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
TAIR|locus:2202960669 RHM1 "rhamnose biosynthesis 1" 0.983 0.994 0.840 3.50000000002e-313
TAIR|locus:2099372664 RHM3 "rhamnose biosynthesis 3" 0.980 0.998 0.823 1.3e-308
TAIR|locus:2024902667 MUM4 "MUCILAGE-MODIFIED 4" [Ar 0.979 0.992 0.817 2.1e-306
TAIR|locus:2015489301 NRS/ER "nucleotide-rhamnose sy 0.437 0.983 0.796 1.5e-129
WB|WBGene00015298631 C01F1.3 [Caenorhabditis elegan 0.464 0.497 0.369 2.7e-92
DICTYBASE|DDB_G0279465434 tgds "putative dTDP-D-glucose 0.390 0.608 0.540 4e-85
MGI|MGI:1923605355 Tgds "TDP-glucose 4,6-dehydrat 0.482 0.918 0.483 2.8e-82
RGD|1306544355 Tgds "TDP-glucose 4,6-dehydrat 0.482 0.918 0.477 2e-81
UNIPROTKB|O95455350 TGDS "dTDP-D-glucose 4,6-dehyd 0.482 0.931 0.471 8.5e-81
UNIPROTKB|A6QLW2355 TGDS "dTDP-D-glucose 4,6-dehyd 0.482 0.918 0.468 2.2e-80
TAIR|locus:2202960 RHM1 "rhamnose biosynthesis 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3004 (1062.5 bits), Expect = 3.5e-313, P = 3.5e-313
 Identities = 564/671 (84%), Positives = 613/671 (91%)

Query:     1 MATVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNF 60
             MA+ YTPKNILITGAAGFIASHV NRLI +YP+YKIVVLDKLDYCSNLKNLNPS+ SPNF
Sbjct:     1 MAS-YTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNF 59

Query:    61 KFIKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK 120
             KF+KGD+ASADLV+ +L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct:    60 KFVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK 119

Query:   121 ITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 180
             +TGQI+RFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct:   120 VTGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 179

Query:   181 PVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTIL 240
             PVITTRGNNVYGPNQFPEKLIPKFILLAM+G+ LPIHGDGSNVRSYLYCEDVAEAF+ +L
Sbjct:   180 PVITTRGNNVYGPNQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYLYCEDVAEAFEVVL 239

Query:   241 HKGEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQ 300
             HKGEVGHVYNIGTKKERRV DVA DICKLF+++P+  IKFV+NRPFNDQRYFLD QKLK+
Sbjct:   240 HKGEVGHVYNIGTKKERRVNDVAKDICKLFNMDPEANIKFVDNRPFNDQRYFLDDQKLKK 299

Query:   301 LGWYERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGK-VDG-HDTTFM 358
             LGW ER TWEEGL+KTM WY  NP+WWGDVSGALLPHPR  M P   G+  DG  D +  
Sbjct:   300 LGWSERTTWEEGLKKTMDWYTQNPEWWGDVSGALLPHPRMLMMPG--GRHFDGSEDNSLA 357

Query:   359 LKINNS-SQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGR 417
               ++   SQ+ MVV + +SN + QKP LKFLIYG+TGWIGGLL KIC+K+GI +EYGKGR
Sbjct:   358 ATLSEKPSQTHMVVPSQRSNGTPQKPSLKFLIYGKTGWIGGLLGKICDKQGIAYEYGKGR 417

Query:   418 LENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENG 477
             LE+RS LL DIQ+VKPTHVFN+AGVTGRPNVDWCE+HK ETIR NV GTLTLADVCRE+G
Sbjct:   418 LEDRSSLLQDIQSVKPTHVFNSAGVTGRPNVDWCESHKTETIRANVAGTLTLADVCREHG 477

Query:   478 LLMMNYATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLR 537
             LLMMN+ATGCIFEYD KHPEG+GIGFKEED PNFTGSFYSKTKAMVEELLKEYDNVCTLR
Sbjct:   478 LLMMNFATGCIFEYDDKHPEGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLR 537

Query:   538 VRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPG 597
             VRMPISSDLNNPRNFITKISRYNKVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPG
Sbjct:   538 VRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPG 597

Query:   598 VVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKES 657
             VVSHNEILEMY+ YI+P FKW NFTLEEQAKVIVAPRSNNE+DASKLKKEFPELLSIKES
Sbjct:   598 VVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKES 657

Query:   658 LIKNVFEPNKK 668
             LIK  + PNKK
Sbjct:   658 LIKYAYGPNKK 668
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0008831 "dTDP-4-dehydrorhamnose reductase activity" evidence=IEA
GO:0009225 "nucleotide-sugar metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0045226 "extracellular polysaccharide biosynthetic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0010253 "UDP-rhamnose biosynthetic process" evidence=IDA;IMP
GO:0050377 "UDP-glucose 4,6-dehydratase activity" evidence=IDA
GO:0010280 "UDP-L-rhamnose synthase activity" evidence=IDA
GO:0010315 "auxin efflux" evidence=IMP
GO:0051555 "flavonol biosynthetic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009813 "flavonoid biosynthetic process" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
TAIR|locus:2099372 RHM3 "rhamnose biosynthesis 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024902 MUM4 "MUCILAGE-MODIFIED 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015489 NRS/ER "nucleotide-rhamnose synthase/epimerase-reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00015298 C01F1.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279465 tgds "putative dTDP-D-glucose 4,6-dehydratase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1923605 Tgds "TDP-glucose 4,6-dehydratase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306544 Tgds "TDP-glucose 4,6-dehydratase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O95455 TGDS "dTDP-D-glucose 4,6-dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLW2 TGDS "dTDP-D-glucose 4,6-dehydratase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SYM5RHM1_ARATH4, ., 2, ., 1, ., -0.84060.98220.9925yesno
Q9LH76RHM3_ARATH4, ., 2, ., 1, ., -0.82330.98070.9984nono
Q9LPG6RHM2_ARATH4, ., 2, ., 1, ., -0.81530.98070.9940nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.46LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
PLN02260668 PLN02260, PLN02260, probable rhamnose biosynthetic 0.0
PLN02778298 PLN02778, PLN02778, 3,5-epimerase/4-reductase 0.0
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 1e-173
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 1e-137
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 1e-123
PRK10217355 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; 9e-85
PRK10084352 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; 1e-83
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 3e-69
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 8e-62
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 1e-61
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 1e-57
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 7e-55
cd08946200 cd08946, SDR_e, extended (e) SDRs 7e-54
cd05230305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 1e-50
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 1e-46
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 5e-46
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 2e-44
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 8e-44
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 1e-43
cd05234305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 2e-39
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 1e-38
TIGR04180297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 3e-36
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 5e-33
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 2e-29
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 5e-29
cd05252336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 2e-28
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 6e-27
PLN02206442 PLN02206, PLN02206, UDP-glucuronate decarboxylase 3e-25
PLN02166436 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase 4e-25
cd05239300 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, exte 4e-24
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro 5e-24
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 2e-23
cd05248317 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannohepto 2e-23
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 5e-23
cd05273328 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP- 7e-23
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 3e-22
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 6e-22
PRK15181348 PRK15181, PRK15181, Vi polysaccharide biosynthesis 6e-21
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 6e-21
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 1e-20
TIGR02197314 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-hep 3e-19
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 8e-19
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 2e-18
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 3e-18
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 2e-17
TIGR02622349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydra 2e-17
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 1e-15
cd08957307 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptic 2e-15
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 2e-15
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5- 6e-15
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 9e-15
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 9e-15
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 2e-14
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 6e-14
PRK11908347 PRK11908, PRK11908, NAD-dependent epimerase/dehydr 4e-13
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 6e-13
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 1e-12
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 4e-12
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 9e-12
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehyd 9e-12
TIGR01746367 TIGR01746, Thioester-redct, thioester reductase do 3e-11
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 4e-11
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 1e-10
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-10
COG3320382 COG3320, COG3320, Putative dehydrogenase domain of 2e-10
TIGR01472343 TIGR01472, gmd, GDP-mannose 4,6-dehydratase 4e-10
TIGR04130337 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehyd 4e-10
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 5e-10
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 3e-09
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 3e-09
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 4e-09
PLN02653340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 5e-09
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 6e-09
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 6e-09
PLN02427386 PLN02427, PLN02427, UDP-apiose/xylose synthase 8e-09
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 1e-08
cd05255382 cd05255, SQD1_like_SDR_e, UDP_sulfoquinovose_synth 2e-08
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 4e-08
cd08946200 cd08946, SDR_e, extended (e) SDRs 5e-08
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 4e-07
cd05262291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 2e-06
cd05261248 cd05261, CAPF_like_SDR_e, capsular polysaccharide 2e-06
cd05266251 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 2e-06
PLN02572442 PLN02572, PLN02572, UDP-sulfoquinovose synthase 4e-05
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 8e-05
PRK08125660 PRK08125, PRK08125, bifunctional UDP-glucuronic ac 1e-04
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 2e-04
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 5e-04
cd05229302 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 5e-04
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 6e-04
cd09812339 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid 6e-04
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 8e-04
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 0.001
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 0.001
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 0.003
>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information 
 Score = 1429 bits (3700), Expect = 0.0
 Identities = 573/664 (86%), Positives = 613/664 (92%), Gaps = 3/664 (0%)

Query: 5   YTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIK 64
           Y PKNILITGAAGFIASHV NRLI NYP+YKIVVLDKLDYCSNLKNLNPS+ SPNFKF+K
Sbjct: 4   YEPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVK 63

Query: 65  GDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQ 124
           GD+ASADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+TGQ
Sbjct: 64  GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ 123

Query: 125 IKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT 184
           I+RFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT
Sbjct: 124 IRRFIHVSTDEVYGETDEDADVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVIT 183

Query: 185 TRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGE 244
           TRGNNVYGPNQFPEKLIPKFILLAM+GKPLPIHGDGSNVRSYLYCEDVAEAF+ +LHKGE
Sbjct: 184 TRGNNVYGPNQFPEKLIPKFILLAMQGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLHKGE 243

Query: 245 VGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWY 304
           VGHVYNIGTKKERRVIDVA DICKLF L+P+  IKFVENRPFNDQRYFLD QKLK+LGW 
Sbjct: 244 VGHVYNIGTKKERRVIDVAKDICKLFGLDPEKSIKFVENRPFNDQRYFLDDQKLKKLGWQ 303

Query: 305 ERVTWEEGLQKTMKWYISNPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNS 364
           ER +WEEGL+KTM+WY SNPDWWGDVSGALLPHPR  M P +       +       ++ 
Sbjct: 304 ERTSWEEGLKKTMEWYTSNPDWWGDVSGALLPHPRMLMMPGVRLFDGSEEIK---LSSSG 360

Query: 365 SQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSKICEKKGIPFEYGKGRLENRSQL 424
           SQ+ +VV    + SS  KP LKFLIYGRTGWIGGLL K+CEK+GI +EYGKGRLE+RS L
Sbjct: 361 SQTGLVVVTKPAGSSPGKPSLKFLIYGRTGWIGGLLGKLCEKQGIAYEYGKGRLEDRSSL 420

Query: 425 LADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMNYA 484
           LADI+NVKPTHVFNAAGVTGRPNVDWCE+HK ETIR NVVGTLTLADVCRENGLLMMN+A
Sbjct: 421 LADIRNVKPTHVFNAAGVTGRPNVDWCESHKVETIRANVVGTLTLADVCRENGLLMMNFA 480

Query: 485 TGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISS 544
           TGCIFEYDAKHPEG+GIGFKEEDKPNFTGSFYSKTKAMVEELL+EYDNVCTLRVRMPISS
Sbjct: 481 TGCIFEYDAKHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREYDNVCTLRVRMPISS 540

Query: 545 DLNNPRNFITKISRYNKVVNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEI 604
           DL+NPRNFITKISRYNKVVNIPNSMT+LDELLPIS+EMAKRNL GIWNFTNPGVVSHNEI
Sbjct: 541 DLSNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEI 600

Query: 605 LEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKNVFE 664
           LEMYK YIDPGFKW+NFTLEEQAKVIVAPRSNNE+DASKLKKEFPELLSIKESLIK VFE
Sbjct: 601 LEMYKDYIDPGFKWSNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYVFE 660

Query: 665 PNKK 668
           PNKK
Sbjct: 661 PNKK 664

Length = 668
>gnl|CDD|178377 PLN02778, PLN02778, 3,5-epimerase/4-reductase Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236649 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase Back     alignment and domain information
>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187559 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannoheptose 6-epimerase (GME), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|185103 PRK15181, PRK15181, Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|233775 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH and WbmG-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|183375 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233427 TIGR01472, gmd, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|200085 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|200085 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|178047 PLN02427, PLN02427, UDP-apiose/xylose synthase Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187565 cd05255, SQD1_like_SDR_e, UDP_sulfoquinovose_synthase (Arabidopsis thaliana SQD1 and related proteins), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|187571 cd05261, CAPF_like_SDR_e, capsular polysaccharide assembling protein (CAPF) like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187576 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 Back     alignment and domain information
>gnl|CDD|215310 PLN02572, PLN02572, UDP-sulfoquinovose synthase Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|236156 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187540 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187672 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid dehydrogenase (3b-HSD)-like, subgroup1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 676
PLN02260668 probable rhamnose biosynthetic enzyme 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PRK07201657 short chain dehydrogenase; Provisional 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
PLN02778298 3,5-epimerase/4-reductase 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PLN02240352 UDP-glucose 4-epimerase 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 100.0
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 100.0
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PLN00016378 RNA-binding protein; Provisional 100.0
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
PLN02686367 cinnamoyl-CoA reductase 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.98
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.98
PLN02260 668 probable rhamnose biosynthetic enzyme 99.97
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.97
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.97
PLN02240352 UDP-glucose 4-epimerase 99.97
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.97
PLN02583297 cinnamoyl-CoA reductase 99.97
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.97
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.97
PLN02996491 fatty acyl-CoA reductase 99.97
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN00198338 anthocyanidin reductase; Provisional 99.97
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.97
PLN02650351 dihydroflavonol-4-reductase 99.97
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.97
PRK05865 854 hypothetical protein; Provisional 99.97
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.97
PLN02896353 cinnamyl-alcohol dehydrogenase 99.97
PLN02778298 3,5-epimerase/4-reductase 99.97
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.96
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.96
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.96
PRK06484520 short chain dehydrogenase; Validated 99.96
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.96
CHL00194317 ycf39 Ycf39; Provisional 99.96
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.96
PLN02686367 cinnamoyl-CoA reductase 99.96
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.96
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.95
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.95
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.95
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.94
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.94
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.94
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.94
CHL00194317 ycf39 Ycf39; Provisional 99.94
PLN02503605 fatty acyl-CoA reductase 2 99.93
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.93
PLN00016378 RNA-binding protein; Provisional 99.93
PLN02583297 cinnamoyl-CoA reductase 99.93
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.93
PLN02996491 fatty acyl-CoA reductase 99.92
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.92
PRK05865 854 hypothetical protein; Provisional 99.92
PRK12320699 hypothetical protein; Provisional 99.92
PRK07201 657 short chain dehydrogenase; Provisional 99.91
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.91
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.9
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.89
COG3320382 Putative dehydrogenase domain of multifunctional n 99.89
KOG2774366 consensus NAD dependent epimerase [General functio 99.88
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.88
PRK06482276 short chain dehydrogenase; Provisional 99.88
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.88
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.88
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.87
PRK12320 699 hypothetical protein; Provisional 99.86
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.86
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.84
PRK08263275 short chain dehydrogenase; Provisional 99.84
PRK09135249 pteridine reductase; Provisional 99.84
PRK05875276 short chain dehydrogenase; Provisional 99.84
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.83
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.83
PLN02503605 fatty acyl-CoA reductase 2 99.83
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.83
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.82
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.82
PRK07775274 short chain dehydrogenase; Provisional 99.82
PRK06914280 short chain dehydrogenase; Provisional 99.81
PRK06180277 short chain dehydrogenase; Provisional 99.81
KOG2774366 consensus NAD dependent epimerase [General functio 99.81
COG3320382 Putative dehydrogenase domain of multifunctional n 99.81
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.81
PRK07774250 short chain dehydrogenase; Provisional 99.81
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.81
PRK06128300 oxidoreductase; Provisional 99.81
PRK06194287 hypothetical protein; Provisional 99.81
PRK07074257 short chain dehydrogenase; Provisional 99.81
PRK07067257 sorbitol dehydrogenase; Provisional 99.8
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.8
PRK05876275 short chain dehydrogenase; Provisional 99.8
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.8
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.8
PLN03209576 translocon at the inner envelope of chloroplast su 99.8
PRK12746254 short chain dehydrogenase; Provisional 99.8
PRK12829264 short chain dehydrogenase; Provisional 99.8
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.79
PRK12828239 short chain dehydrogenase; Provisional 99.79
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.79
PRK07890258 short chain dehydrogenase; Provisional 99.79
PRK06482276 short chain dehydrogenase; Provisional 99.79
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.79
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.78
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.78
PRK12827249 short chain dehydrogenase; Provisional 99.78
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.78
PRK06138252 short chain dehydrogenase; Provisional 99.78
PRK12939250 short chain dehydrogenase; Provisional 99.78
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.78
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.78
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.78
PRK07806248 short chain dehydrogenase; Provisional 99.77
PRK07060245 short chain dehydrogenase; Provisional 99.77
PRK08219227 short chain dehydrogenase; Provisional 99.77
PRK06123248 short chain dehydrogenase; Provisional 99.77
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.77
PRK06179270 short chain dehydrogenase; Provisional 99.77
PRK07985294 oxidoreductase; Provisional 99.77
PRK06182273 short chain dehydrogenase; Validated 99.77
PRK06701290 short chain dehydrogenase; Provisional 99.76
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.76
PLN02253280 xanthoxin dehydrogenase 99.76
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.75
PRK09134258 short chain dehydrogenase; Provisional 99.75
PRK05717255 oxidoreductase; Validated 99.75
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.75
PRK06523260 short chain dehydrogenase; Provisional 99.75
PRK08628258 short chain dehydrogenase; Provisional 99.75
PRK06500249 short chain dehydrogenase; Provisional 99.75
PRK07577234 short chain dehydrogenase; Provisional 99.74
PRK09186256 flagellin modification protein A; Provisional 99.74
PRK07856252 short chain dehydrogenase; Provisional 99.74
PRK06181263 short chain dehydrogenase; Provisional 99.74
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.74
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.74
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK08264238 short chain dehydrogenase; Validated 99.74
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.74
PRK09135249 pteridine reductase; Provisional 99.73
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.73
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.73
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.73
PRK07814263 short chain dehydrogenase; Provisional 99.73
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.73
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK08324681 short chain dehydrogenase; Validated 99.73
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.72
PRK06398258 aldose dehydrogenase; Validated 99.72
PRK06841255 short chain dehydrogenase; Provisional 99.72
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.72
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.72
PRK07024257 short chain dehydrogenase; Provisional 99.72
PRK05993277 short chain dehydrogenase; Provisional 99.72
PRK08643256 acetoin reductase; Validated 99.72
PRK12747252 short chain dehydrogenase; Provisional 99.71
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.71
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.71
PRK07454241 short chain dehydrogenase; Provisional 99.71
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.71
PRK09242257 tropinone reductase; Provisional 99.71
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.71
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.71
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.71
PRK12743256 oxidoreductase; Provisional 99.71
PRK12937245 short chain dehydrogenase; Provisional 99.71
PRK10538248 malonic semialdehyde reductase; Provisional 99.71
PRK06172253 short chain dehydrogenase; Provisional 99.71
PRK07478254 short chain dehydrogenase; Provisional 99.71
PRK07035252 short chain dehydrogenase; Provisional 99.71
PRK07806248 short chain dehydrogenase; Provisional 99.71
PRK12744257 short chain dehydrogenase; Provisional 99.7
PRK06198260 short chain dehydrogenase; Provisional 99.7
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.7
PRK07063260 short chain dehydrogenase; Provisional 99.7
PRK09291257 short chain dehydrogenase; Provisional 99.7
PRK06196315 oxidoreductase; Provisional 99.7
PRK06947248 glucose-1-dehydrogenase; Provisional 99.7
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.7
PRK08277278 D-mannonate oxidoreductase; Provisional 99.7
PRK08263275 short chain dehydrogenase; Provisional 99.69
PRK07774250 short chain dehydrogenase; Provisional 99.69
PRK05650270 short chain dehydrogenase; Provisional 99.69
PRK07677252 short chain dehydrogenase; Provisional 99.69
PRK05875276 short chain dehydrogenase; Provisional 99.69
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.69
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.69
PRK07041230 short chain dehydrogenase; Provisional 99.69
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.69
PRK07326237 short chain dehydrogenase; Provisional 99.68
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.68
PRK07109334 short chain dehydrogenase; Provisional 99.68
PRK06180277 short chain dehydrogenase; Provisional 99.68
PRK06114254 short chain dehydrogenase; Provisional 99.68
PRK08017256 oxidoreductase; Provisional 99.68
PRK07067257 sorbitol dehydrogenase; Provisional 99.68
PRK08267260 short chain dehydrogenase; Provisional 99.68
PRK08226263 short chain dehydrogenase; Provisional 99.68
PRK08265261 short chain dehydrogenase; Provisional 99.68
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.68
PRK07576264 short chain dehydrogenase; Provisional 99.68
PRK12742237 oxidoreductase; Provisional 99.68
PRK07775274 short chain dehydrogenase; Provisional 99.68
PRK06194287 hypothetical protein; Provisional 99.68
PRK08589272 short chain dehydrogenase; Validated 99.68
PRK06057255 short chain dehydrogenase; Provisional 99.68
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.68
PRK05867253 short chain dehydrogenase; Provisional 99.67
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.67
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.67
PRK07825273 short chain dehydrogenase; Provisional 99.67
PRK05693274 short chain dehydrogenase; Provisional 99.67
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.67
PRK06101240 short chain dehydrogenase; Provisional 99.67
PRK08339263 short chain dehydrogenase; Provisional 99.67
PRK06949258 short chain dehydrogenase; Provisional 99.66
PRK12746254 short chain dehydrogenase; Provisional 99.66
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.66
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK08219227 short chain dehydrogenase; Provisional 99.66
PRK07069251 short chain dehydrogenase; Validated 99.66
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.65
PRK07074257 short chain dehydrogenase; Provisional 99.65
PRK08936261 glucose-1-dehydrogenase; Provisional 99.65
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.65
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.65
PRK06914280 short chain dehydrogenase; Provisional 99.65
PRK05872296 short chain dehydrogenase; Provisional 99.65
PRK06139330 short chain dehydrogenase; Provisional 99.65
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.65
PRK05866293 short chain dehydrogenase; Provisional 99.64
PRK06128300 oxidoreductase; Provisional 99.64
PRK08251248 short chain dehydrogenase; Provisional 99.64
PRK06483236 dihydromonapterin reductase; Provisional 99.64
PRK06197306 short chain dehydrogenase; Provisional 99.64
PRK07102243 short chain dehydrogenase; Provisional 99.64
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.64
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.64
PRK07023243 short chain dehydrogenase; Provisional 99.63
PRK07578199 short chain dehydrogenase; Provisional 99.63
PLN03209 576 translocon at the inner envelope of chloroplast su 99.63
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
PRK07890258 short chain dehydrogenase; Provisional 99.63
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.63
PRK09134258 short chain dehydrogenase; Provisional 99.63
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.62
PRK07831262 short chain dehydrogenase; Provisional 99.62
PRK12829264 short chain dehydrogenase; Provisional 99.62
PRK06123248 short chain dehydrogenase; Provisional 99.62
PRK05717255 oxidoreductase; Validated 99.62
PRK07904253 short chain dehydrogenase; Provisional 99.62
PRK06924251 short chain dehydrogenase; Provisional 99.61
PRK07791286 short chain dehydrogenase; Provisional 99.61
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.61
PRK07062265 short chain dehydrogenase; Provisional 99.61
PRK05876275 short chain dehydrogenase; Provisional 99.61
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK12827249 short chain dehydrogenase; Provisional 99.61
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.6
PLN02253280 xanthoxin dehydrogenase 99.6
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
PRK06701290 short chain dehydrogenase; Provisional 99.6
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.6
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.6
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
PRK08278273 short chain dehydrogenase; Provisional 99.6
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
COG0300265 DltE Short-chain dehydrogenases of various substra 99.59
PRK09072263 short chain dehydrogenase; Provisional 99.59
PRK06940275 short chain dehydrogenase; Provisional 99.59
PRK06500249 short chain dehydrogenase; Provisional 99.59
PRK06484520 short chain dehydrogenase; Validated 99.59
PRK06182273 short chain dehydrogenase; Validated 99.59
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.59
PRK12828239 short chain dehydrogenase; Provisional 99.59
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.59
PRK08628258 short chain dehydrogenase; Provisional 99.59
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.59
PRK06181263 short chain dehydrogenase; Provisional 99.59
PRK07060245 short chain dehydrogenase; Provisional 99.58
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.58
PRK09186256 flagellin modification protein A; Provisional 99.58
PRK05993277 short chain dehydrogenase; Provisional 99.58
PRK08703239 short chain dehydrogenase; Provisional 99.58
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.58
PRK05854313 short chain dehydrogenase; Provisional 99.58
PRK06179270 short chain dehydrogenase; Provisional 99.57
PRK08340259 glucose-1-dehydrogenase; Provisional 99.57
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.57
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.57
PRK07832272 short chain dehydrogenase; Provisional 99.57
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.57
PRK06138252 short chain dehydrogenase; Provisional 99.57
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.57
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.57
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.57
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.57
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.56
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
PRK09009235 C factor cell-cell signaling protein; Provisional 99.56
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
PRK10538248 malonic semialdehyde reductase; Provisional 99.56
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.56
PRK06125259 short chain dehydrogenase; Provisional 99.56
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.56
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.55
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.55
PRK07985294 oxidoreductase; Provisional 99.55
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK12744257 short chain dehydrogenase; Provisional 99.55
PRK06953222 short chain dehydrogenase; Provisional 99.54
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.54
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.54
COG2910211 Putative NADH-flavin reductase [General function p 99.54
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.54
PRK06101240 short chain dehydrogenase; Provisional 99.54
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
PRK07024257 short chain dehydrogenase; Provisional 99.54
PRK08264238 short chain dehydrogenase; Validated 99.54
PRK06947248 glucose-1-dehydrogenase; Provisional 99.53
PRK12743256 oxidoreductase; Provisional 99.53
PRK06523260 short chain dehydrogenase; Provisional 99.53
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.53
PRK12367245 short chain dehydrogenase; Provisional 99.53
PRK12939250 short chain dehydrogenase; Provisional 99.53
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.52
PRK12937245 short chain dehydrogenase; Provisional 99.52
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.52
PRK05855582 short chain dehydrogenase; Validated 99.52
PRK06398258 aldose dehydrogenase; Validated 99.52
PRK08643256 acetoin reductase; Validated 99.52
PRK07577234 short chain dehydrogenase; Provisional 99.52
PRK08177225 short chain dehydrogenase; Provisional 99.51
PRK06841255 short chain dehydrogenase; Provisional 99.51
PRK08267260 short chain dehydrogenase; Provisional 99.51
PRK05884223 short chain dehydrogenase; Provisional 99.51
PRK12747252 short chain dehydrogenase; Provisional 99.51
PRK07856252 short chain dehydrogenase; Provisional 99.51
PRK07578199 short chain dehydrogenase; Provisional 99.51
PRK08265261 short chain dehydrogenase; Provisional 99.51
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07102243 short chain dehydrogenase; Provisional 99.5
PRK12742237 oxidoreductase; Provisional 99.5
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.5
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.5
PRK07825273 short chain dehydrogenase; Provisional 99.5
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.49
PRK05866293 short chain dehydrogenase; Provisional 99.49
PRK07454241 short chain dehydrogenase; Provisional 99.48
PRK08017256 oxidoreductase; Provisional 99.48
PRK06196315 oxidoreductase; Provisional 99.48
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.48
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.48
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.48
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.48
PRK05650270 short chain dehydrogenase; Provisional 99.47
PRK07109334 short chain dehydrogenase; Provisional 99.47
PRK07814263 short chain dehydrogenase; Provisional 99.47
PRK08324681 short chain dehydrogenase; Validated 99.47
PRK06949258 short chain dehydrogenase; Provisional 99.47
PRK07326237 short chain dehydrogenase; Provisional 99.47
PRK05693274 short chain dehydrogenase; Provisional 99.47
PRK05599246 hypothetical protein; Provisional 99.46
PRK06057255 short chain dehydrogenase; Provisional 99.46
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.46
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.46
PRK08251248 short chain dehydrogenase; Provisional 99.46
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.46
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.45
PRK08589272 short chain dehydrogenase; Validated 99.45
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.45
PRK09291257 short chain dehydrogenase; Provisional 99.45
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.45
COG0300265 DltE Short-chain dehydrogenases of various substra 99.45
PRK07035252 short chain dehydrogenase; Provisional 99.44
PRK07041230 short chain dehydrogenase; Provisional 99.44
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.44
PRK06198260 short chain dehydrogenase; Provisional 99.44
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.44
PRK07023243 short chain dehydrogenase; Provisional 99.44
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.44
PRK05867253 short chain dehydrogenase; Provisional 99.43
PRK06139330 short chain dehydrogenase; Provisional 99.43
PLN02780320 ketoreductase/ oxidoreductase 99.43
PRK05854313 short chain dehydrogenase; Provisional 99.43
PRK08226263 short chain dehydrogenase; Provisional 99.43
PRK09072263 short chain dehydrogenase; Provisional 99.43
PRK07677252 short chain dehydrogenase; Provisional 99.43
PRK06172253 short chain dehydrogenase; Provisional 99.43
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.43
PRK06197306 short chain dehydrogenase; Provisional 99.42
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.42
PRK07478254 short chain dehydrogenase; Provisional 99.42
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.42
PRK06483236 dihydromonapterin reductase; Provisional 99.42
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.42
PRK07063260 short chain dehydrogenase; Provisional 99.42
PRK07576264 short chain dehydrogenase; Provisional 99.42
PRK06114254 short chain dehydrogenase; Provisional 99.42
PRK08277278 D-mannonate oxidoreductase; Provisional 99.41
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.41
PRK08278273 short chain dehydrogenase; Provisional 99.41
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.41
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.41
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.4
PRK08303305 short chain dehydrogenase; Provisional 99.4
PRK09242257 tropinone reductase; Provisional 99.4
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.4
PRK05872296 short chain dehydrogenase; Provisional 99.39
PRK07069251 short chain dehydrogenase; Validated 99.39
PRK06953222 short chain dehydrogenase; Provisional 99.38
PRK06924251 short chain dehydrogenase; Provisional 99.38
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.38
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.38
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.37
PRK07904253 short chain dehydrogenase; Provisional 99.37
PRK12367245 short chain dehydrogenase; Provisional 99.37
PRK07832272 short chain dehydrogenase; Provisional 99.36
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.36
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.36
PRK08339263 short chain dehydrogenase; Provisional 99.36
PRK08936261 glucose-1-dehydrogenase; Provisional 99.36
PRK08862227 short chain dehydrogenase; Provisional 99.36
PRK08703239 short chain dehydrogenase; Provisional 99.35
PRK05855582 short chain dehydrogenase; Validated 99.35
PLN00015308 protochlorophyllide reductase 99.35
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.34
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information 
Probab=100.00  E-value=3.4e-87  Score=748.24  Aligned_cols=663  Identities=87%  Similarity=1.376  Sum_probs=547.0

Q ss_pred             CCCCCCeEEEEcCCchhHHHHHHHHHHcCCCcEEEEEcCCCccccccCCCCCCCCCCeEEEEecCCCHHHHHHHHccCCC
Q 005818            3 TVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKI   82 (676)
Q Consensus         3 ~~~~~~~vlVtGatG~iG~~l~~~L~~~g~~~~v~~~~r~~~~~~~~~~~~~~~~~~v~~v~~Dl~d~~~~~~~~~~~~~   82 (676)
                      ++++.|+|||||||||||++|++.|++++++++|+++++.........+.......+++++.+|+.|.+.+..++...++
T Consensus         2 ~~~~~~~VLVTGatGfIG~~lv~~Ll~~g~~~~V~~~d~~~~~~~~~~l~~~~~~~~v~~~~~Dl~d~~~~~~~~~~~~~   81 (668)
T PLN02260          2 ATYEPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIASADLVNYLLITEGI   81 (668)
T ss_pred             CCCCCCEEEEECCCcHHHHHHHHHHHHhCCCCEEEEEeCCCccchhhhhhhcccCCCeEEEECCCCChHHHHHHHhhcCC
Confidence            45677899999999999999999999998789999998753222222222222245799999999999998887766789


Q ss_pred             CEEEEccccCCcCCcCCChHHHHHHHHHHHHHHHHHHHHcCCCceEEEEecccccCCCCCCcCCCCCCCCCCCCCChhHH
Q 005818           83 DTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSA  162 (676)
Q Consensus        83 d~Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~  162 (676)
                      |+|||+|+....+.++.++.++++.|+.++.+|+++|++.+.+++|||+||..+||.....+..+..|+.+..|.++|+.
T Consensus        82 D~ViHlAa~~~~~~~~~~~~~~~~~Nv~gt~~ll~a~~~~~~vkr~I~~SS~~vyg~~~~~~~~~~~E~~~~~p~~~Y~~  161 (668)
T PLN02260         82 DTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDADVGNHEASQLLPTNPYSA  161 (668)
T ss_pred             CEEEECCCccCchhhhhCHHHHHHHHHHHHHHHHHHHHhcCCCcEEEEEcchHHhCCCccccccCccccCCCCCCCCcHH
Confidence            99999999987666666777889999999999999999987689999999999999876544334466777778999999


Q ss_pred             HHHHHHHHHHHHHHHcCCCEEEEeeCCccCCCCCCCChHHHHHHHHHCCCCceeecCCCceEeeeeHHHHHHHHHHHHhc
Q 005818          163 TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHK  242 (676)
Q Consensus       163 sK~~~E~~~~~~~~~~~l~~~ilR~~~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~D~a~ai~~~~~~  242 (676)
                      +|..+|.+++.+.++++++++++||++||||+..+..+++.++..+..+.++++++++.+.++|+|++|+++++..++++
T Consensus       162 sK~~aE~~v~~~~~~~~l~~vilR~~~VyGp~~~~~~~i~~~~~~a~~g~~i~i~g~g~~~r~~ihV~Dva~a~~~~l~~  241 (668)
T PLN02260        162 TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMQGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLHK  241 (668)
T ss_pred             HHHHHHHHHHHHHHHcCCCEEEECcccccCcCCCcccHHHHHHHHHhCCCCeEEecCCCceEeeEEHHHHHHHHHHHHhc
Confidence            99999999999988889999999999999999876678888888888888899999999999999999999999999987


Q ss_pred             CCCCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceeeecCCCCCCcccccCHHHHHhCCCcccCCHHHHHHHHHHHHhh
Q 005818          243 GEVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQLGWYERVTWEEGLQKTMKWYIS  322 (676)
Q Consensus       243 ~~~~~~y~i~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~~lg~~~~~~~~~~l~~~~~~~~~  322 (676)
                      ...+++||+++++++++.|+++.+++.+|.++...+...+.+++....+.+|++|+++|||+|+++++++|+++++|+++
T Consensus       242 ~~~~~vyni~~~~~~s~~el~~~i~~~~g~~~~~~i~~~~~~p~~~~~~~~d~~k~~~lGw~p~~~~~egl~~~i~w~~~  321 (668)
T PLN02260        242 GEVGHVYNIGTKKERRVIDVAKDICKLFGLDPEKSIKFVENRPFNDQRYFLDDQKLKKLGWQERTSWEEGLKKTMEWYTS  321 (668)
T ss_pred             CCCCCEEEECCCCeeEHHHHHHHHHHHhCCCCcceeeecCCCCCCcceeecCHHHHHHcCCCCCCCHHHHHHHHHHHHHh
Confidence            76788999999999999999999999999865544555555666666778999999999999999999999999999999


Q ss_pred             CCCCcccccccCCCCCccCcCCCccCccCCCCccchhhccCCccccceeecccCCCCCCCCccEEEEEcCCcchhHHHHH
Q 005818          323 NPDWWGDVSGALLPHPRTSMAPAIEGKVDGHDTTFMLKINNSSQSRMVVRASKSNSSRQKPFLKFLIYGRTGWIGGLLSK  402 (676)
Q Consensus       323 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vlitG~~G~iG~~l~~  402 (676)
                      +..||..+.+++.+||+..+.++.... +..++.....  +.................+..+||||||||+||||++|++
T Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~mkiLVtGa~G~iG~~l~~  398 (668)
T PLN02260        322 NPDWWGDVSGALLPHPRMLMMPGVRLF-DGSEEIKLSS--SGSQTGLVVVTKPAGSSPGKPSLKFLIYGRTGWIGGLLGK  398 (668)
T ss_pred             ChhhhhccccccccCCCcccccccccc-cchhhhcccc--ccccccccccccccccCCCCCCceEEEECCCchHHHHHHH
Confidence            999999999999999999888876444 3333322100  1111111111122234445566899999999999999999


Q ss_pred             HHHHcCCceeeccccCCChHHHHHHhhccCCCEEEECccccCCCCcchhccchhhHHhhhhhhHHHHHHHHHHcCCcEEE
Q 005818          403 ICEKKGIPFEYGKGRLENRSQLLADIQNVKPTHVFNAAGVTGRPNVDWCETHKPETIRTNVVGTLTLADVCRENGLLMMN  482 (676)
Q Consensus       403 ~L~~~g~~v~~~~~Dl~d~~~~~~~~~~~~~d~Vih~a~~~~~~~~~~~~~~~~~~~~~Nv~g~~~ll~a~~~~~~~~v~  482 (676)
                      .|.++|++|.+..+|++|.+.+.+++...+||+||||||.++.+++++++.++..++++|+.|+.+|+++|++.++++|+
T Consensus       399 ~L~~~g~~v~~~~~~l~d~~~v~~~i~~~~pd~Vih~Aa~~~~~~~~~~~~~~~~~~~~N~~gt~~l~~a~~~~g~~~v~  478 (668)
T PLN02260        399 LCEKQGIAYEYGKGRLEDRSSLLADIRNVKPTHVFNAAGVTGRPNVDWCESHKVETIRANVVGTLTLADVCRENGLLMMN  478 (668)
T ss_pred             HHHhCCCeEEeeccccccHHHHHHHHHhhCCCEEEECCcccCCCCCChHHhCHHHHHHHHhHHHHHHHHHHHHcCCeEEE
Confidence            99999999977789999999999999988999999999988655677888899999999999999999999999999999


Q ss_pred             eecCeeeecCCCCCCCCCCCccccCCCCCCCCchhhhHHHHHHHHHHccCeEEEEeeecccCCCCChHHHHHHHHhcCce
Q 005818          483 YATGCIFEYDAKHPEGTGIGFKEEDKPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKV  562 (676)
Q Consensus       483 ~sS~~v~~~~~~~~~~~~~~~~~e~~~~~p~~~Y~~sK~~~E~~~~~~~~~~~l~~~~~r~~~~~g~~~~~~~~~~~~~~  562 (676)
                      +||++||++....+.+.+.++.|++.+..+.+.||.||+++|++++.+.+..++|+.+++.+..+++.+|+..+++....
T Consensus       479 ~Ss~~v~~~~~~~~~~~~~p~~E~~~~~~~~~~Yg~sK~~~E~~~~~~~~~~~~r~~~~~~~~~~~~~nfv~~~~~~~~~  558 (668)
T PLN02260        479 FATGCIFEYDAKHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNFITKISRYNKV  558 (668)
T ss_pred             EcccceecCCcccccccCCCCCcCCCCCCCCChhhHHHHHHHHHHHhhhhheEEEEEEecccCCCCccHHHHHHhcccee
Confidence            99999997643222222335666666666669999999999999998888889999999987777788999999988776


Q ss_pred             eccCCCccchhhHHHHHHHHHhcCCCceeEccCCCcccHHHHHHHHHhhcCCCCcccccchHhhhhHhccCCCccccChh
Q 005818          563 VNIPNSMTILDELLPISVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNELDAS  642 (676)
Q Consensus       563 ~~~~~~~~~v~D~a~~~~~~~~~~~~g~yn~~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~ld~~  642 (676)
                      +..+.+..+++|++.+++.+++...+|+||+++++.+|+.||++.|++.++....+.++...++.....++|+...||++
T Consensus       559 ~~vp~~~~~~~~~~~~~~~l~~~~~~giyni~~~~~~s~~e~a~~i~~~~~~~~~~~~~~~~~~~~~~~a~rp~~~l~~~  638 (668)
T PLN02260        559 VNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKDYIDPGFKWSNFTLEEQAKVIVAPRSNNEMDAS  638 (668)
T ss_pred             eccCCCceehhhHHHHHHHHHHhCCCceEEecCCCcCcHHHHHHHHHHhcCCcccccccCHHHhhhHhhCCCccccccHH
Confidence            66666788899999998888876667999999999999999999999988644336667666655345666765599999


Q ss_pred             HHHhhCCCCCCHHHHHHHhhhccCCC
Q 005818          643 KLKKEFPELLSIKESLIKNVFEPNKK  668 (676)
Q Consensus       643 k~~~~~~~~~~~~~~l~~~~~~~~~~  668 (676)
                      |+++.++.+++|+++|++++.+++++
T Consensus       639 k~~~~~~~~~~~~~~l~~~~~~~~~~  664 (668)
T PLN02260        639 KLKKEFPELLSIKESLIKYVFEPNKK  664 (668)
T ss_pred             HHHHhCccccchHHHHHHHHhhhhhh
Confidence            99987777789999999999888765

>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
2hun_A336 Crystal Structure Of Hypothetical Protein Ph0414 Fr 1e-68
4egb_A346 3.0 Angstrom Resolution Crystal Structure Of Dtdp-G 2e-68
1g1a_A361 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 2e-65
1bxk_A355 Dtdp-Glucose 4,6-Dehydratase From E. Coli Length = 2e-65
1r66_A337 Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydr 1e-63
1r6d_A337 Crystal Structure Of Desiv Double Mutant (Dtdp-Gluc 1e-62
1kep_A348 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 3e-52
3ehe_A313 Crystal Structure Of Udp-Glucose 4 Epimerase (Gale- 2e-26
4ef7_B337 Udp-Xylose Synthase Length = 337 2e-25
3vps_A321 Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5 2e-25
2p5u_A311 Crystal Structure Of Thermus Thermophilus Hb8 Udp-G 2e-24
2b69_A343 Crystal Structure Of Human Udp-Glucoronic Acid Deca 2e-24
2pzj_A377 Crystal Structure Of The Bordetella Bronchiseptica 3e-24
1kvs_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-23
2pk3_A321 Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose 3e-23
3icp_A312 Crystal Structure Of Udp-Galactose 4-Epimerase Leng 4e-23
1lrj_A338 Crystal Structure Of E. Coli Udp-Galactose 4-Epimer 5e-23
2udp_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 6e-23
1kvq_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 7e-23
1kvr_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 9e-23
1kvt_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 9e-23
1kvu_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-22
1a9z_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-22
1a9y_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-22
1lrk_A338 Crystal Structure Of Escherichia Coli Udp-Galactose 6e-22
3aw9_A308 Structure Of Udp-Galactose 4-Epimerase Mutant Lengt 6e-22
1orr_A347 Crystal Structure Of Cdp-tyvelose 2-epimerase Compl 9e-22
2c20_A330 Crystal Structure Of Udp-Glucose 4-Epimerase Length 6e-21
3lu1_A364 Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4- 2e-19
3ru9_A351 Specific Recognition Of N-Acetylated Substrates And 3e-19
3ru7_A351 Specific Recognition Of N-Acetylated Substrates And 3e-19
3ruc_A351 Specific Recognition Of N-Acetylated Substrates And 4e-19
3sxp_A362 Crystal Structure Of Helicobacter Pylori Adp-L-Glyc 3e-17
1sb8_A352 Crystal Structure Of Pseudomonas Aeruginosa Udp-N-A 5e-17
1e6u_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Le 1e-14
1bws_A321 Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose E 2e-14
1z45_A699 Crystal Structure Of The Gal10 Fusion Protein Galac 2e-14
1bsv_A321 Gdp-Fucose Synthetase From Escherichia Coli Complex 6e-14
1e7q_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S1 6e-14
1e7s_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K1 9e-14
1e7r_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y1 5e-13
1wvg_A359 Structure Of Cdp-D-Glucose 4,6-Dehydratase From Sal 2e-12
3m2p_A311 The Crystal Structure Of Udp-N-Acetylglucosamine 4- 5e-11
3enk_A341 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase F 4e-10
1rkx_A357 Crystal Structure At 1.8 Angstrom Of Cdp-D-Glucose 5e-10
1gy8_A397 Trypanosoma Brucei Udp-Galactose 4' Epimerase Lengt 4e-09
1z75_A358 Crystal Structure Of Arna Dehydrogenase (decarboxyl 7e-09
2c59_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 1e-08
1z74_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 2e-08
2c54_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 2e-08
1u9j_A358 Crystal Structure Of E. Coli Arna (Pmri) Decarboxyl 2e-08
2bll_A345 Apo-Structure Of The C-Terminal Decarboxylase Domai 3e-08
1db3_A372 E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 3e-08
1z7b_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 3e-08
1z73_A358 Crystal Structure Of E. Coli Arna Dehydrogenase (de 4e-08
2c5a_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 4e-08
1z7e_A660 Crystal Structure Of Full Length Arna Length = 660 4e-08
2c5e_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 5e-08
1ek5_A348 Structure Of Human Udp-Galactose 4-Epimerase In Com 6e-08
1hzj_A348 Human Udp-Galactose 4-Epimerase: Accommodation Of U 6e-08
1i3k_A348 Molecular Basis For Severe Epimerase-Deficiency Gal 1e-07
2q1w_A333 Crystal Structure Of The Bordetella Bronchiseptica 5e-07
4f6l_B508 Crystal Structure Of Aureusimine Biosynthetic Clust 7e-07
1t2a_A375 Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydr 1e-06
2gn4_A344 Crystal Structure Of Udp-Glcnac Inverting 4,6-Dehyd 2e-06
1n7g_A381 Crystal Structure Of The Gdp-mannose 4,6-dehydratas 3e-06
4f6c_A427 Crystal Structure Of Aureusimine Biosynthetic Clust 1e-05
3a1n_A317 Crystal Structure Of L-Threonine Dehydrogenase From 3e-05
3a9w_A317 Crystal Structure Of L-Threonine Bound L-Threonine 9e-05
1rpn_A335 Crystal Structure Of Gdp-D-Mannose 4,6-Dehydratase 1e-04
3rft_A267 Crystal Structure Of Uronate Dehydrogenase From Agr 5e-04
2z1m_A345 Crystal Structure Of Gdp-D-Mannose Dehydratase From 8e-04
>pdb|2HUN|A Chain A, Crystal Structure Of Hypothetical Protein Ph0414 From Pyrococcus Horikoshii Ot3 Length = 336 Back     alignment and structure 
Iteration: 1

 Score =  257 bits (657), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/330 (40%), Positives = 201/330 (60%), Gaps = 7/330 (2%)
Query: 10  ILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVAS 69
           +L+TG  GFI S+    ++  +P+++++ +DKL Y SN  NL      P + F+KGDVA 
Sbjct: 6   LLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVAD 65
Query: 70  ADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFI 129
            +LV    L  K+D ++H AA++HVD S  +   F  +N+ GT+ LLE+ +      RF+
Sbjct: 66  YELVKE--LVRKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPEVRFV 123
Query: 130 HVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNN 189
           HVSTDEVYG+  + +   N    +L+P++PYSATKA ++MLV+ + R+Y L    TR  N
Sbjct: 124 HVSTDEVYGDILKGSFTEN---DRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTN 180
Query: 190 VYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEVGHVY 249
            YGP QFPEKLIPK I+ A  G  +PI+G G NVR +LY ED   A + +L KGE   +Y
Sbjct: 181 NYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGESREIY 240
Query: 250 NIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKL-KQLGWYERVT 308
           NI   +E+  ++V   I +L     +  I+ VE+RP +D RY LD  K+ + L W  + T
Sbjct: 241 NISAGEEKTNLEVVKIILRLMG-KGEELIELVEDRPGHDLRYSLDSWKITRDLKWRPKYT 299
Query: 309 WEEGLQKTMKWYISNPDWWGDVSGALLPHP 338
           ++EG++KT+ WY+ N  WW  +    + HP
Sbjct: 300 FDEGIKKTIDWYLKNEWWWKPLVDERILHP 329
>pdb|4EGB|A Chain A, 3.0 Angstrom Resolution Crystal Structure Of Dtdp-Glucose 4,6- Dehydratase (Rfbb) From Bacillus Anthracis Str. Ames In Complex With Nad Length = 346 Back     alignment and structure
>pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb)from Salmonella Enterica Serovar Typhimurium Length = 361 Back     alignment and structure
>pdb|1BXK|A Chain A, Dtdp-Glucose 4,6-Dehydratase From E. Coli Length = 355 Back     alignment and structure
>pdb|1R66|A Chain A, Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydratase) From Streptomyces Venezuelae With Nad And Tyd Bound Length = 337 Back     alignment and structure
>pdb|1R6D|A Chain A, Crystal Structure Of Desiv Double Mutant (Dtdp-Glucose 4,6- Dehydratase) From Streptomyces Venezuelae With Nad And Dau Bound Length = 337 Back     alignment and structure
>pdb|1KEP|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb) From Streptococcus Suis With Dtdp-Xylose Bound Length = 348 Back     alignment and structure
>pdb|3EHE|A Chain A, Crystal Structure Of Udp-Glucose 4 Epimerase (Gale-1) From Archaeoglobus Fulgidus Length = 313 Back     alignment and structure
>pdb|3VPS|A Chain A, Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5,6-Dehydratase, Tuna, Involved In Tunicamycin Biosynthesis Length = 321 Back     alignment and structure
>pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 Back     alignment and structure
>pdb|2B69|A Chain A, Crystal Structure Of Human Udp-Glucoronic Acid Decarboxylase Length = 343 Back     alignment and structure
>pdb|2PZJ|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmf In Complex With Nad+ Length = 377 Back     alignment and structure
>pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|2PK3|A Chain A, Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose Reductase Length = 321 Back     alignment and structure
>pdb|3ICP|A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase Length = 312 Back     alignment and structure
>pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 Back     alignment and structure
>pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 Back     alignment and structure
>pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|3AW9|A Chain A, Structure Of Udp-Galactose 4-Epimerase Mutant Length = 308 Back     alignment and structure
>pdb|1ORR|A Chain A, Crystal Structure Of Cdp-tyvelose 2-epimerase Complexed With Nad And Cdp Length = 347 Back     alignment and structure
>pdb|2C20|A Chain A, Crystal Structure Of Udp-Glucose 4-Epimerase Length = 330 Back     alignment and structure
>pdb|3LU1|A Chain A, Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4-Epimerase Length = 364 Back     alignment and structure
>pdb|3RU9|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|3RU7|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|3RUC|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|3SXP|A Chain A, Crystal Structure Of Helicobacter Pylori Adp-L-Glycero-D-Manno- Heptose-6-Epimerase (Rfad, Hp0859) Length = 362 Back     alignment and structure
>pdb|1SB8|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Udp-N-Acetylglucosamine 4- Epimerase Complexed With Udp-N-Acetylgalactosamine Length = 352 Back     alignment and structure
>pdb|1E6U|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Length = 321 Back     alignment and structure
>pdb|1BWS|A Chain A, Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose EpimeraseREDUCTASE From Escherichia Coli A Key Enzyme In The Biosynthesis Of Gdp-L- Fucose Length = 321 Back     alignment and structure
>pdb|1Z45|A Chain A, Crystal Structure Of The Gal10 Fusion Protein Galactose MutarotaseUDP-Galactose 4-Epimerase From Saccharomyces Cerevisiae Complexed With Nad, Udp-Glucose, And Galactose Length = 699 Back     alignment and structure
>pdb|1BSV|A Chain A, Gdp-Fucose Synthetase From Escherichia Coli Complex With Nadph Length = 321 Back     alignment and structure
>pdb|1E7Q|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S107a Length = 321 Back     alignment and structure
>pdb|1E7S|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K140r Length = 321 Back     alignment and structure
>pdb|1E7R|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y136e Length = 321 Back     alignment and structure
>pdb|1WVG|A Chain A, Structure Of Cdp-D-Glucose 4,6-Dehydratase From Salmonella Typhi Length = 359 Back     alignment and structure
>pdb|3M2P|A Chain A, The Crystal Structure Of Udp-N-Acetylglucosamine 4-Epimerase From Bacillus Cereus Length = 311 Back     alignment and structure
>pdb|3ENK|A Chain A, 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase From Burkholderia Pseudomallei Length = 341 Back     alignment and structure
>pdb|1RKX|A Chain A, Crystal Structure At 1.8 Angstrom Of Cdp-D-Glucose 4,6- Dehydratase From Yersinia Pseudotuberculosis Length = 357 Back     alignment and structure
>pdb|1GY8|A Chain A, Trypanosoma Brucei Udp-Galactose 4' Epimerase Length = 397 Back     alignment and structure
>pdb|1Z75|A Chain A, Crystal Structure Of Arna Dehydrogenase (decarboxylase) Domain, R619m Mutant Length = 358 Back     alignment and structure
>pdb|2C59|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), With Gdp-Alpha-D-Mannose And Gdp-Beta-L-Galactose Bound In The Active Site. Length = 379 Back     alignment and structure
>pdb|1Z74|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619y Mutant Length = 358 Back     alignment and structure
>pdb|2C54|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K178r, With Gdp-Beta-L-Gulose And Gdp-4-Keto-Beta-L-Gulose Bound In Active Site. Length = 379 Back     alignment and structure
>pdb|1U9J|A Chain A, Crystal Structure Of E. Coli Arna (Pmri) Decarboxylase Domain Length = 358 Back     alignment and structure
>pdb|2BLL|A Chain A, Apo-Structure Of The C-Terminal Decarboxylase Domain Of Arna Length = 345 Back     alignment and structure
>pdb|1DB3|A Chain A, E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 Back     alignment and structure
>pdb|1Z7B|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619e Mutant Length = 358 Back     alignment and structure
>pdb|1Z73|A Chain A, Crystal Structure Of E. Coli Arna Dehydrogenase (decarboxylase) Domain, S433a Mutant Length = 358 Back     alignment and structure
>pdb|2C5A|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), Y174f, With Gdp-Beta-L-Galactose Bound In The Active Site Length = 379 Back     alignment and structure
>pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>pdb|2C5E|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K217a, With Gdp-Alpha-D-Mannose Bound In The Active Site. Length = 379 Back     alignment and structure
>pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimerase In Complex With Nad+ Length = 348 Back     alignment and structure
>pdb|1HZJ|A Chain A, Human Udp-Galactose 4-Epimerase: Accommodation Of Udp-N- Acetylglucosamine Within The Active Site Length = 348 Back     alignment and structure
>pdb|1I3K|A Chain A, Molecular Basis For Severe Epimerase-Deficiency Galactosemia: X-Ray Structure Of The Human V94m- Substituted Udp-Galactose 4-Epimerase Length = 348 Back     alignment and structure
>pdb|2Q1W|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmh In Complex With Nad+ Length = 333 Back     alignment and structure
>pdb|4F6L|B Chain B, Crystal Structure Of Aureusimine Biosynthetic Cluster Reductase Domain Length = 508 Back     alignment and structure
>pdb|1T2A|A Chain A, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase Length = 375 Back     alignment and structure
>pdb|2GN4|A Chain A, Crystal Structure Of Udp-Glcnac Inverting 4,6-Dehydratase In Complex With Nadph And Udp-Glcnac Length = 344 Back     alignment and structure
>pdb|1N7G|A Chain A, Crystal Structure Of The Gdp-mannose 4,6-dehydratase Ternary Complex With Nadph And Gdp-rhamnose. Length = 381 Back     alignment and structure
>pdb|4F6C|A Chain A, Crystal Structure Of Aureusimine Biosynthetic Cluster Reductase Domain Length = 427 Back     alignment and structure
>pdb|3A1N|A Chain A, Crystal Structure Of L-Threonine Dehydrogenase From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|3A9W|A Chain A, Crystal Structure Of L-Threonine Bound L-Threonine Dehydrogenase (Y137f) From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|1RPN|A Chain A, Crystal Structure Of Gdp-D-Mannose 4,6-Dehydratase In Complexes With Gdp And Nadph Length = 335 Back     alignment and structure
>pdb|3RFT|A Chain A, Crystal Structure Of Uronate Dehydrogenase From Agrobacterium Tumefaciens Length = 267 Back     alignment and structure
>pdb|2Z1M|A Chain A, Crystal Structure Of Gdp-D-Mannose Dehydratase From Aquifex Aeolicus Vf5 Length = 345 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 1e-140
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 1e-139
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 1e-136
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 1e-134
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 1e-133
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 1e-130
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 1e-111
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 1e-103
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 3e-90
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 2e-85
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 3e-05
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 6e-82
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 1e-76
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 2e-76
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 3e-71
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 4e-06
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 3e-69
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 5e-04
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 3e-69
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 3e-66
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 2e-06
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 3e-65
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 2e-62
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 7e-62
3slg_A372 PBGP3 protein; structural genomics, seattle struct 1e-58
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 4e-58
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 2e-56
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 2e-04
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 2e-56
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 2e-56
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 1e-54
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 1e-51
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 2e-51
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 2e-06
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 6e-43
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 2e-41
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 8e-41
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 3e-04
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 1e-40
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 7e-34
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 4e-30
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 2e-29
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 1e-28
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 2e-28
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 9e-28
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 3e-26
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 3e-25
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 2e-22
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 5e-20
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 6e-20
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 7e-20
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 3e-19
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 6e-19
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 7e-19
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 4e-16
1xq6_A253 Unknown protein; structural genomics, protein stru 1e-14
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 4e-14
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 1e-10
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 1e-13
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 9e-12
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 2e-11
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 9e-10
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 3e-11
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 5e-10
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 3e-11
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 6e-11
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 1e-09
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 2e-09
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 7e-09
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 1e-08
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 1e-08
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 6e-07
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 1e-08
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 2e-08
3ius_A286 Uncharacterized conserved protein; APC63810, silic 2e-08
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 2e-08
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 9e-08
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 1e-07
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-07
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 2e-07
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 3e-07
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 9e-07
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 2e-06
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 2e-06
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 3e-06
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 4e-06
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 8e-05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 6e-04
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 1e-04
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Length = 336 Back     alignment and structure
 Score =  411 bits (1060), Expect = e-140
 Identities = 132/330 (40%), Positives = 198/330 (60%), Gaps = 8/330 (2%)

Query: 6   TPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKG 65
               +L+TG  GFI S+    ++  +P+++++ +DKL Y SN  NL      P + F+KG
Sbjct: 2   HSMKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKG 61

Query: 66  DVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQI 125
           DVA  +LV  ++   K+D ++H AA++HVD S  +   F  +N+ GT+ LLE+ +     
Sbjct: 62  DVADYELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPE 119

Query: 126 KRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITT 185
            RF+HVSTDEVYG+  + +     E  +L+P++PYSATKA ++MLV+ + R+Y L    T
Sbjct: 120 VRFVHVSTDEVYGDILKGSF---TENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASIT 176

Query: 186 RGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGEV 245
           R  N YGP QFPEKLIPK I+ A  G  +PI+G G NVR +LY ED   A + +L KGE 
Sbjct: 177 RCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGES 236

Query: 246 GHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLK-QLGWY 304
             +YNI   +E+  ++V   I +L     +  I+ VE+RP +D RY LD  K+   L W 
Sbjct: 237 REIYNISAGEEKTNLEVVKIILRLMG-KGEELIELVEDRPGHDLRYSLDSWKITRDLKWR 295

Query: 305 ERVTWEEGLQKTMKWYISNPDWWGDV-SGA 333
            + T++EG++KT+ WY+ N  WW  +    
Sbjct: 296 PKYTFDEGIKKTIDWYLKNEWWWKPLVDER 325
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Length = 346 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Length = 337 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Length = 348 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Length = 361 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Length = 321 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 335 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Length = 372 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Length = 345 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 375 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Length = 381 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 100.0
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 100.0
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 100.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.98
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.98
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.98
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.98
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.98
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.98
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.98
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.97
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.97
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.97
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.97
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.97
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.97
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.97
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.97
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.97
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.97
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.97
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.97
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.97
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.97
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.96
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.96
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.96
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.96
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.96
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.96
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.96
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.96
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.96
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.96
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.95
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.94
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.94
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.94
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.94
1xq6_A253 Unknown protein; structural genomics, protein stru 99.94
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.94
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.94
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.94
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.94
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.94
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.93
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.93
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.93
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.93
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.93
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.93
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.92
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.92
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.92
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.92
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.92
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.91
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.91
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.91
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.91
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.91
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.91
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.91
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.9
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.9
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.89
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.89
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.89
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.89
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.89
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.89
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.89
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.89
1xq6_A253 Unknown protein; structural genomics, protein stru 99.89
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.89
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.88
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.88
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.88
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.88
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.88
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.88
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.88
1spx_A278 Short-chain reductase family member (5L265); paral 99.87
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.87
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.87
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.87
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.87
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.87
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.87
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.87
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.87
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.87
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.87
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.87
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.87
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.86
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.86
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.86
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.86
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.86
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.85
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.85
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.85
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.85
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.85
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.85
3rih_A293 Short chain dehydrogenase or reductase; structural 99.85
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.85
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.85
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.85
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.85
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.85
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.85
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.85
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.85
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.85
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.85
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.85
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.84
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.84
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.84
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.84
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.84
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.84
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.84
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.84
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.84
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.84
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.84
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.84
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.84
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.84
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.84
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.84
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.84
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.84
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.84
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.84
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.84
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.84
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.83
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.83
4e4y_A244 Short chain dehydrogenase family protein; structur 99.83
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.83
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.83
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.83
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.83
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.83
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.83
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.83
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.83
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.83
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.83
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.83
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.83
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.83
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.83
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.83
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.83
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.83
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.83
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.83
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.83
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.83
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.83
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.83
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.82
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.82
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.82
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.82
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.82
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.82
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.82
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.82
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.82
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.82
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.82
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.82
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.82
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.82
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.82
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.82
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.82
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.82
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.82
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.82
3cxt_A291 Dehydrogenase with different specificities; rossma 99.82
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.82
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.82
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.82
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.82
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.82
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.82
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.82
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.82
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.82
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.82
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.81
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.81
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.81
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.81
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.81
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.81
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.81
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.81
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.81
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.81
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.81
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.81
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.81
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.81
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.81
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.81
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.81
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.81
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.81
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.81
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.81
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.81
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.81
1xkq_A280 Short-chain reductase family member (5D234); parra 99.81
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.81
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.81
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.81
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.8
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.8
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.8
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.8
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.8
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.8
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.8
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.8
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.8
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.8
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.8
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.79
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.79
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.79
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.79
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.79
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.79
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.79
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.79
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.79
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.79
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.79
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.79
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.79
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.78
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.78
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.78
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.78
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.78
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.78
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.78
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.78
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.78
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.78
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.78
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.78
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.77
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.77
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.77
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.77
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.77
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.77
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.76
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.76
1spx_A278 Short-chain reductase family member (5L265); paral 99.76
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.76
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.76
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.76
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.76
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.76
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.76
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.76
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.75
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.75
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.75
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.75
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.75
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.75
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.75
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.74
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.74
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.74
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.74
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.74
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.74
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.74
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.74
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.74
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.74
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.74
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.74
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.74
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.74
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.73
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.73
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.73
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.73
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.73
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.73
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.72
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.72
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.72
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.72
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.72
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.72
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.72
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.72
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.72
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.72
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.72
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.72
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.72
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.72
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.72
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.72
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.72
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.72
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.72
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.72
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.72
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.71
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.71
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.71
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.71
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.71
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.71
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.71
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.71
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.71
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.71
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.71
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.71
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.71
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.71
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.7
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.7
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.7
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.7
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.7
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.7
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.7
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.7
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.7
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.7
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.7
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.7
3rih_A293 Short chain dehydrogenase or reductase; structural 99.7
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.7
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.7
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.7
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.7
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.7
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.7
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.7
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.7
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.7
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.7
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.7
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.69
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.69
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.69
4e4y_A244 Short chain dehydrogenase family protein; structur 99.69
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.69
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.69
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.69
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.69
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.69
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.69
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.69
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.69
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.69
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.68
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.68
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.68
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.68
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.68
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.68
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.68
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.68
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.68
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.68
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.68
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.68
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.68
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.68
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.68
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.68
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.68
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.68
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.67
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.67
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.67
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.67
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.67
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.67
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.67
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.67
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.67
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.67
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.67
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=381.90  Aligned_cols=322  Identities=41%  Similarity=0.752  Sum_probs=272.0

Q ss_pred             CCCCeEEEEcCCchhHHHHHHHHHHcCCCcEEEEEcCCCccccccCCCCCCCCCCeEEEEecCCCHHHHHHHHccCCCCE
Q 005818            5 YTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKIDT   84 (676)
Q Consensus         5 ~~~~~vlVtGatG~iG~~l~~~L~~~g~~~~v~~~~r~~~~~~~~~~~~~~~~~~v~~v~~Dl~d~~~~~~~~~~~~~d~   84 (676)
                      +++|+|||||||||||++|++.|+++|+.++|++++|.........+.......+++++.+|+.|++.+.+++...++|+
T Consensus        22 ~~~~~vlVtGatG~iG~~l~~~L~~~g~~~~v~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~d~  101 (346)
T 4egb_A           22 SNAMNILVTGGAGFIGSNFVHYMLQSYETYKIINFDALTYSGNLNNVKSIQDHPNYYFVKGEIQNGELLEHVIKERDVQV  101 (346)
T ss_dssp             --CEEEEEETTTSHHHHHHHHHHHHHCTTEEEEEEECCCTTCCGGGGTTTTTCTTEEEEECCTTCHHHHHHHHHHHTCCE
T ss_pred             cCCCeEEEECCccHHHHHHHHHHHhhCCCcEEEEEeccccccchhhhhhhccCCCeEEEEcCCCCHHHHHHHHhhcCCCE
Confidence            34579999999999999999999999777999999987543333333333344689999999999999999996556999


Q ss_pred             EEEccccCCcCCcCCChHHHHHHHHHHHHHHHHHHHHcCCCceEEEEecccccCCCCCCcCCCCCCCCCCCCCChhHHHH
Q 005818           85 IMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATK  164 (676)
Q Consensus        85 Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~sK  164 (676)
                      |||+|+......+..++...++.|+.++.+|+++|++.+ +++|||+||.++|+.....  ....|+++..|.++|+.+|
T Consensus       102 Vih~A~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~-~~~~v~~SS~~vy~~~~~~--~~~~E~~~~~p~~~Y~~sK  178 (346)
T 4egb_A          102 IVNFAAESHVDRSIENPIPFYDTNVIGTVTLLELVKKYP-HIKLVQVSTDEVYGSLGKT--GRFTEETPLAPNSPYSSSK  178 (346)
T ss_dssp             EEECCCCC---------CHHHHHHTHHHHHHHHHHHHST-TSEEEEEEEGGGGCCCCSS--CCBCTTSCCCCCSHHHHHH
T ss_pred             EEECCcccchhhhhhCHHHHHHHHHHHHHHHHHHHHhcC-CCEEEEeCchHHhCCCCcC--CCcCCCCCCCCCChhHHHH
Confidence            999999987666667788899999999999999999987 8999999999999987422  2337888889999999999


Q ss_pred             HHHHHHHHHHHHHcCCCEEEEeeCCccCCCCCCCChHHHHHHHHHCCCCceeecCCCceEeeeeHHHHHHHHHHHHhcCC
Q 005818          165 AGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKGE  244 (676)
Q Consensus       165 ~~~E~~~~~~~~~~~l~~~ilR~~~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~D~a~ai~~~~~~~~  244 (676)
                      ..+|.+++.++++++++++++||+.||||+..+..+++.++..+..+.++.+++++.+.++|+|++|+|++++.+++++.
T Consensus       179 ~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~Dva~a~~~~~~~~~  258 (346)
T 4egb_A          179 ASADMIALAYYKTYQLPVIVTRCSNNYGPYQYPEKLIPLMVTNALEGKKLPLYGDGLNVRDWLHVTDHCSAIDVVLHKGR  258 (346)
T ss_dssp             HHHHHHHHHHHHHHCCCEEEEEECEEESTTCCTTSHHHHHHHHHHTTCCCEEETTSCCEECEEEHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHhCCCEEEEeecceeCcCCCccchHHHHHHHHHcCCCceeeCCCCeEEeeEEHHHHHHHHHHHHhcCC
Confidence            99999999999888999999999999999987778899999999999999999999999999999999999999999887


Q ss_pred             CCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceeeecCCCCCCcccccCHHHHH-hCCCcccCCHHHHHHHHHHHHhhC
Q 005818          245 VGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLK-QLGWYERVTWEEGLQKTMKWYISN  323 (676)
Q Consensus       245 ~~~~y~i~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~-~lg~~~~~~~~~~l~~~~~~~~~~  323 (676)
                      .+++||+++++++|+.|+++.+.+.+|.+.+. +.+.+..+.....+.+|.+|++ .|||+|+++++++|+++++||+++
T Consensus       259 ~g~~~~i~~~~~~s~~e~~~~i~~~~g~~~~~-~~~~~~~~~~~~~~~~d~~k~~~~lG~~p~~~~~e~l~~~~~~~~~~  337 (346)
T 4egb_A          259 VGEVYNIGGNNEKTNVEVVEQIITLLGKTKKD-IEYVTDRLGHDRRYAINAEKMKNEFDWEPKYTFEQGLQETVQWYEKN  337 (346)
T ss_dssp             TTCEEEECCSCCEEHHHHHHHHHHHHTCCGGG-CEEECC--CCCSCCCBCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHC
T ss_pred             CCCEEEECCCCceeHHHHHHHHHHHhCCCccc-ccccCCCCCCcceeeccHHHHHHHcCCCCCCCHHHHHHHHHHHHHhh
Confidence            88899999999999999999999999986542 4444555555567789999998 599999999999999999999999


Q ss_pred             CCCcccc
Q 005818          324 PDWWGDV  330 (676)
Q Consensus       324 ~~~~~~~  330 (676)
                      ..||+..
T Consensus       338 ~~~~~~~  344 (346)
T 4egb_A          338 EEWWKPL  344 (346)
T ss_dssp             HHHHGGG
T ss_pred             hhhhhhc
Confidence            8888764
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 676
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-99
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-14
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-84
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-08
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 1e-82
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-12
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-70
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-07
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 7e-68
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 4e-13
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-63
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 7e-06
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 1e-58
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 1e-04
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 2e-58
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 5e-58
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 6e-07
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 2e-57
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 1e-10
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 5e-54
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 0.003
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 1e-50
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-50
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 8e-49
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 3e-06
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 1e-45
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 4e-43
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 3e-31
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 3e-25
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 1e-24
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 2e-22
d1eq2a_307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 1e-18
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 6e-18
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 9e-07
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 8e-17
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 6e-14
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 0.001
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 2e-13
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 3e-09
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 7e-09
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 6e-07
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 2e-06
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 6e-05
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-04
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 0.001
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.003
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptococcus suis, serotype 2 [TaxId: 1307]

 Score =  306 bits (784), Expect = 5e-99
 Identities = 136/344 (39%), Positives = 194/344 (56%), Gaps = 23/344 (6%)

Query: 9   NILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVA 68
            ILITG AGFI S V   +I N  +  +V +DKL Y  NL++L+    S  + F   D+ 
Sbjct: 2   KILITGGAGFIGSAVVRHIIKNTQD-TVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 69  SADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITG----- 123
            +  +  I    + D +MH AA++HVD S      F + NI GT+ LLE  +        
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 124 ---QIKRFIHVSTDEVYGETDEDAVVGNH-------EASQLLPTNPYSATKAGAEMLVMA 173
                 RF H+STDEVYG+      V N        E +   P++PYSA+KA ++ LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 174 YGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVA 233
           + R+YGLP I T  +N YGP  FPEKLIP  IL A++GKPLPI+G G  +R +LY ED A
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 234 EAFDTILHKGEVGHVYNIGTKKERRVIDVATDICKL------FSLNPDTQIKFVENRPFN 287
            A   ++ +G+ G  YNIG   E++ +DV   IC L       + +   QI +V +RP +
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 288 DQRYFLDVQKLKQ-LGWYERVTWEEGLQKTMKWYISNPDWWGDV 330
           D+RY +D  K+ + LGW    T+E G++KT++WY++N  W  +V
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQWVNNV 344
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.97
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.97
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.97
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.96
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.96
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.96
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.92
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.92
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.89
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.88
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.88
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.87
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.85
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.84
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.84
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.82
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.81
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.8
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.8
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.76
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.75
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.74
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.74
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.74
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.73
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.72
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.72
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.72
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.71
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.71
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.71
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.71
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.7
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.7
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.7
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.7
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.69
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.69
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.69
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.69
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.69
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.69
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.68
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.68
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.68
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.67
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.67
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.66
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.65
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.65
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.65
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.65
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.64
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.63
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.63
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.63
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.62
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.61
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.61
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.61
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.61
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.61
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.6
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.59
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.57
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.56
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.56
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.55
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.55
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.54
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.54
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.54
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.53
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.53
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.53
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.52
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.52
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.52
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.52
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.52
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.52
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.52
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.51
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.51
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.51
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.51
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.51
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.51
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.5
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.5
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.49
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.49
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.49
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.48
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.48
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.48
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.48
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.47
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.47
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.47
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.46
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.46
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.45
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.44
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.43
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.43
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.43
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.42
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.42
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.42
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.41
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.41
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.4
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.4
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.39
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.38
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.38
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.38
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.38
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.37
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.37
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.36
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.36
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.36
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.33
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.33
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.32
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.32
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.3
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.29
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.29
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.26
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.26
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.25
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.24
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.23
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.22
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.18
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.14
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.11
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.11
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.11
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.09
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.06
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.03
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.91
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.89
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.88
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.82
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.71
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.67
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.64
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.47
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.03
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.73
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.73
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.64
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.58
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.57
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.45
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.41
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.39
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.34
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.28
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.28
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.22
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.21
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.17
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.17
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.15
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.08
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.07
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.02
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.98
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.97
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.89
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.88
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.87
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.87
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.86
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.8
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.8
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.73
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.7
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.69
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.68
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.68
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.65
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.63
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.57
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.54
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.41
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.31
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.31
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.3
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.29
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.28
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.27
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.27
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.27
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.1
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.98
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.94
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.92
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.88
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.88
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.86
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.85
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.83
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.81
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.8
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.76
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.75
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.71
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.57
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.56
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.5
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.46
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.39
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.39
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.38
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.37
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.14
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.03
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.01
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.99
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.83
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.81
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.78
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.72
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 94.61
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.6
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.58
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.5
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.49
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.41
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.27
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.16
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.11
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.95
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.95
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.92
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.83
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.73
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.66
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 93.52
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.43
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.03
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 93.0
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.91
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 92.88
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.82
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.7
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.62
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.58
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 92.44
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 92.44
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.41
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.31
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.17
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.99
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.93
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.81
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 91.7
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.65
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 91.57
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.48
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.44
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.43
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.29
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.18
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.08
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.07
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.02
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.02
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 90.93
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.88
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.74
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 90.73
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 90.68
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.54
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.53
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 90.52
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 90.47
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.47
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.4
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 90.35
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 90.2
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.19
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 90.12
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.06
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.7
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 89.66
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 89.45
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.23
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 89.19
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.17
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.98
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.96
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.68
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.54
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 88.35
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.26
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.23
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 88.06
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.04
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.04
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.98
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 87.96
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.88
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.87
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 87.86
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.72
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.7
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 87.69
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.58
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.41
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 87.24
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 87.22
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.15
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.1
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 86.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 86.91
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.59
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 86.44
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 86.42
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 86.41
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 86.23
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 86.03
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 85.98
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 85.97
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.81
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 85.73
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.59
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 85.5
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 85.12
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 85.1
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.06
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 84.82
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 84.81
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 84.17
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 84.05
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.95
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.93
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 83.61
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.52
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 83.45
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 83.4
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.3
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 83.2
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.11
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.07
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.85
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 82.59
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 82.54
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 82.53
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.26
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 82.24
d1iu8a_206 Pyrrolidone carboxyl peptidase (pyroglutamate amin 82.23
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 81.88
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.59
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 81.48
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 81.47
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 81.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 81.37
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 81.34
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 81.24
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 81.21
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 80.89
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 80.89
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 80.61
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 80.57
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 80.42
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 80.41
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 80.4
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.32
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 80.23
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 80.06
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 80.04
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]

Probab=100.00  E-value=4.7e-47  Score=385.85  Aligned_cols=316  Identities=38%  Similarity=0.688  Sum_probs=278.6

Q ss_pred             CeEEEEcCCchhHHHHHHHHHHcCCCc----EEEEEcCCCccccccCCCCCCCCCCeEEEEecCCCHHHHHHHHccCCCC
Q 005818            8 KNILITGAAGFIASHVCNRLIGNYPEY----KIVVLDKLDYCSNLKNLNPSRLSPNFKFIKGDVASADLVHFILLTEKID   83 (676)
Q Consensus         8 ~~vlVtGatG~iG~~l~~~L~~~g~~~----~v~~~~r~~~~~~~~~~~~~~~~~~v~~v~~Dl~d~~~~~~~~~~~~~d   83 (676)
                      |||||||||||||++|++.|+++|+.+    +++.+++.........+.......+++++.+|+.+........  ..+|
T Consensus         1 MkIlItG~tGfIG~~l~~~L~~~g~~v~~~~~i~~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~--~~~d   78 (322)
T d1r6da_           1 MRLLVTGGAGFIGSHFVRQLLAGAYPDVPADEVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLAREL--RGVD   78 (322)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTSCTTSCCSEEEEEECCCTTCCGGGGGGGTTCTTEEEEECCTTCHHHHHHHT--TTCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCccCCceEEEEeCCCccccHhHhhhhhcCCCeEEEEeccccchhhhccc--cccc
Confidence            589999999999999999999997543    6777776554443333333445678999999999999888776  8999


Q ss_pred             EEEEccccCCcCCcCCChHHHHHHHHHHHHHHHHHHHHcCCCceEEEEecccccCCCCCCcCCCCCCCCCCCCCChhHHH
Q 005818           84 TIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKITGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSAT  163 (676)
Q Consensus        84 ~Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~s  163 (676)
                      +|+|+|+.........++...++.|+.|+.+|+++|++.+ +++|||+||.++||.....+.   +|+++..|.++|+.+
T Consensus        79 ~vi~~a~~~~~~~~~~~~~~~~~~N~~gt~~ll~~~~~~~-~~~~I~~Ss~~~yg~~~~~~~---~E~~~~~p~~~Y~~s  154 (322)
T d1r6da_          79 AIVHFAAESHVDRSIAGASVFTETNVQGTQTLLQCAVDAG-VGRVVHVSTNQVYGSIDSGSW---TESSPLEPNSPYAAS  154 (322)
T ss_dssp             EEEECCSCCCHHHHHHCCHHHHHHHTHHHHHHHHHHHHTT-CCEEEEEEEGGGGCCCSSSCB---CTTSCCCCCSHHHHH
T ss_pred             eEEeecccccccccccchHHHhhhhHHHHHHHHHHHHHcC-CceEEEeecceeecCCCCCCC---CCCCCCCCCCHHHHH
Confidence            9999999988777777888899999999999999999987 899999999999998876554   788899999999999


Q ss_pred             HHHHHHHHHHHHHHcCCCEEEEeeCCccCCCCCCCChHHHHHHHHHCCCCceeecCCCceEeeeeHHHHHHHHHHHHhcC
Q 005818          164 KAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMKGKPLPIHGDGSNVRSYLYCEDVAEAFDTILHKG  243 (676)
Q Consensus       164 K~~~E~~~~~~~~~~~l~~~ilR~~~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~D~a~ai~~~~~~~  243 (676)
                      |..+|.+++.++++++++++++||++||||++.+..+++.+++.+..++++.++++|.+.|+|+|++|+|+++..+++++
T Consensus       155 K~~~E~~~~~~~~~~~~~~~~lR~~~vyGp~~~~~~~i~~~i~~~~~~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~~  234 (322)
T d1r6da_         155 KAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGG  234 (322)
T ss_dssp             HHHHHHHHHHHHHHHCCCEEEEEECEEECTTCCTTSHHHHHHHHHHTTCCEEEETTSCCEEEEEEHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHhCCCEEEEEeeeEECcCCCcCcHHHHHHHHHHcCCCcEEecCCCeEEccEEHHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999998878899999999999999999999999999999999999999999998


Q ss_pred             CCCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceeeecCCCCCCcccccCHHHHHh-CCCcccCCHHHHHHHHHHHHhh
Q 005818          244 EVGHVYNIGTKKERRVIDVATDICKLFSLNPDTQIKFVENRPFNDQRYFLDVQKLKQ-LGWYERVTWEEGLQKTMKWYIS  322 (676)
Q Consensus       244 ~~~~~y~i~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~~-lg~~~~~~~~~~l~~~~~~~~~  322 (676)
                      ..+++||+++++++++.|+++.+++.+|.+.+. +.....++.....+.+|++|+++ |||+|+++++++|+++++||++
T Consensus       235 ~~~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~  313 (322)
T d1r6da_         235 RAGEIYHIGGGLELTNRELTGILLDSLGADWSS-VRKVADRKGHDLRYSLDGGKIERELGYRPQVSFADGLARTVRWYRE  313 (322)
T ss_dssp             CTTCEEEECCCCEEEHHHHHHHHHHHHTCCGGG-EEEECCCTTCCCBCCBCCHHHHHHHCCCCCSCHHHHHHHHHHHHHH
T ss_pred             CCCCeeEEeecccchhHHHHHHHHHHhCCCccc-eeecCCCCCCCceeeeCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Confidence            888999999999999999999999999976542 34445566666678899999985 9999999999999999999999


Q ss_pred             CCCCcccc
Q 005818          323 NPDWWGDV  330 (676)
Q Consensus       323 ~~~~~~~~  330 (676)
                      ++.||+.+
T Consensus       314 n~~~~~~~  321 (322)
T d1r6da_         314 NRGWWEPL  321 (322)
T ss_dssp             CHHHHGGG
T ss_pred             hHHhHhhC
Confidence            99999864
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1iu8a_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure