Citrus Sinensis ID: 005822
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 675 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VZD4 | 709 | Glyoxysomal processing pr | yes | no | 0.863 | 0.822 | 0.525 | 1e-173 | |
| Q2T9J0 | 566 | Peroxisomal leader peptid | no | no | 0.131 | 0.157 | 0.373 | 4e-08 | |
| Q9DBA6 | 568 | Peroxisomal leader peptid | yes | no | 0.106 | 0.126 | 0.412 | 5e-07 | |
| P45129 | 466 | Probable periplasmic seri | yes | no | 0.136 | 0.197 | 0.355 | 3e-05 | |
| P0C0V0 | 474 | Periplasmic serine endopr | N/A | no | 0.149 | 0.213 | 0.35 | 0.0007 | |
| P0C0V1 | 474 | Periplasmic serine endopr | N/A | no | 0.149 | 0.213 | 0.35 | 0.0007 | |
| P26982 | 475 | Periplasmic serine endopr | yes | no | 0.149 | 0.212 | 0.35 | 0.0008 |
| >sp|Q8VZD4|DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana GN=DEG15 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 607 bits (1566), Expect = e-173, Method: Compositional matrix adjust.
Identities = 337/641 (52%), Positives = 429/641 (66%), Gaps = 58/641 (9%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLS-FFDTK 59
M + ++ FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG TLSASG+LLP F +
Sbjct: 1 MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60
Query: 60 VAERNWGVNG----LIVTVASVVEPFLLPQYRDKDTSEGQP-ELITGSQIDFLVEGKLRS 114
VA + G L++TVASVVEPFL +R + P +LI G+ I+ +VEG+L+S
Sbjct: 61 VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSSISQDPVKLIPGAMIEIMVEGQLKS 120
Query: 115 EKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSS 174
EKE +P WV AQL+ LVD+PVSS ALQSL+EASSG + W++GWSL N S
Sbjct: 121 EKE-------APFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGS 173
Query: 175 QPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIAL 234
QP +IE LM+ ++E N + M+KS +R+AILGV L P++
Sbjct: 174 QP-----SINIEHYSKPLMQ------LDEPHNANFMAKSATRMAILGVPLSLLGQPSMNF 222
Query: 235 TPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEG 294
+ +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP S +SL++AD+RCLPGMEG
Sbjct: 223 ASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEG 282
Query: 295 GPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKG 353
PVF ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP
Sbjct: 283 APVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP------------ 330
Query: 354 NLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLL 413
+ G + + S +L+ D+ + + I+KA+ SVCLIT++DGVWASG++L
Sbjct: 331 --SVEGKASQWGSEVLSVKS-------DASIPAQVAIEKAMESVCLITVNDGVWASGIIL 381
Query: 414 NDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQP-----EDSASSGHTGVDQYQKSQTLP 468
N+ GLILTNAHLLEPWR+GK G G F+P E+ +S+G +Q KSQTLP
Sbjct: 382 NEHGLILTNAHLLEPWRYGK----GGVYGEGFKPYVLGAEEFSSTGSKFWEQ--KSQTLP 435
Query: 469 PKMPKIVDSSVDEH-RAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLL 527
K P+ SSV E+ R YK + GHR IRVRL HLD W WC A +VY+CK LD++LL
Sbjct: 436 RKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTWCPANVVYICKEQLDIALL 495
Query: 528 QLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYG 587
QL Y+P +L PI A+F P LG+ A+V+GHGLFGPRCGLSPS+ SGVVAKVV A
Sbjct: 496 QLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNT 555
Query: 588 QSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVT 628
QS Q + +P MLETTAAVHPGGSGGAV+N GHMIGLVT
Sbjct: 556 QSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVT 596
|
Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens GN=TYSND1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus GN=Tysnd1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P45129|HTOA_HAEIN Probable periplasmic serine protease do/HhoA-like OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1259 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V1|DEGP_ECO57 Periplasmic serine endoprotease DegP OS=Escherichia coli O157:H7 GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P26982|DEGP_SALTY Periplasmic serine endoprotease DegP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 675 | ||||||
| 224077082 | 752 | predicted protein [Populus trichocarpa] | 0.955 | 0.857 | 0.625 | 0.0 | |
| 224125536 | 716 | predicted protein [Populus trichocarpa] | 0.885 | 0.835 | 0.646 | 0.0 | |
| 359483482 | 753 | PREDICTED: LOW QUALITY PROTEIN: glyoxyso | 0.912 | 0.818 | 0.605 | 0.0 | |
| 255536763 | 729 | trypsin domain-containing protein, putat | 0.934 | 0.865 | 0.578 | 0.0 | |
| 297740411 | 682 | unnamed protein product [Vitis vinifera] | 0.816 | 0.807 | 0.565 | 0.0 | |
| 356546634 | 749 | PREDICTED: glyoxysomal processing protea | 0.905 | 0.815 | 0.570 | 0.0 | |
| 111183165 | 753 | putative protease/hydrolase [Solanum lyc | 0.918 | 0.823 | 0.524 | 0.0 | |
| 357446685 | 819 | Peroxisomal leader peptide-processing pr | 0.914 | 0.753 | 0.515 | 1e-177 | |
| 297851284 | 713 | hypothetical protein ARALYDRAFT_473044 [ | 0.869 | 0.823 | 0.522 | 1e-172 | |
| 18086453 | 709 | At1g28320/F3H9_2 [Arabidopsis thaliana] | 0.863 | 0.822 | 0.527 | 1e-171 |
| >gi|224077082|ref|XP_002305124.1| predicted protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 803 bits (2074), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 426/681 (62%), Positives = 509/681 (74%), Gaps = 36/681 (5%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKV 60
MGLPE+ +F+RNF V+VR+QGPDPKGLKMR+HAFHQYNSGKTTLSASG+LLP + +D +
Sbjct: 1 MGLPEIVDFARNFAVMVRIQGPDPKGLKMRKHAFHQYNSGKTTLSASGLLLPDTLYDADL 60
Query: 61 AER-----NWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK--LR 113
A R + G+ GL+VTVASV+EPFL ++R+ S+ +PELI G+QID + EGK LR
Sbjct: 61 ANRILEGKSQGL-GLVVTVASVIEPFLSSKHRES-ISQSRPELIPGAQIDVMAEGKSDLR 118
Query: 114 SEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNS 173
+ + +DKG+ W+ AQ++ LVD+P+SSLALQSL+EASSG H WEVGWSLA N
Sbjct: 119 NGAD-GGLDKGTSHWLRAQVIRLVDVPLSSLALQSLVEASSGSMNHGWEVGWSLASPENG 177
Query: 174 SQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIA 233
SQ M VV+T E S+ ES R A EESSN S+M KST+RVAILGV +LKDLPN
Sbjct: 178 SQSFMDVVQTQTEHGNASIAESQR-RAREESSNPSIMGKSTTRVAILGVFLHLKDLPNFE 236
Query: 234 LTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGME 293
++ ++RGD LLAVGSPFGVLSP+HFFNS+S+GS+ANCYPPRS+ SLLMADIRCLPGME
Sbjct: 237 ISASSRRGDFLLAVGSPFGVLSPVHFFNSLSVGSIANCYPPRSSDISLLMADIRCLPGME 296
Query: 294 GGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINK 352
G PVF E+++F+GILIRPLRQKS GAEIQLVIPWEAIA ACSDLLLKEPQNAEK IHINK
Sbjct: 297 GSPVFCENSNFIGILIRPLRQKSSGAEIQLVIPWEAIALACSDLLLKEPQNAEKGIHINK 356
Query: 353 GNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVL 412
NLNAVGN+ +S +G K+EH S C SP P++KA+AS+CLITID+ VWASGVL
Sbjct: 357 ENLNAVGNAYSSSS---DGPFPLKHEHHISYCSSPPPVEKAMASICLITIDELVWASGVL 413
Query: 413 LNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQ-----PEDSASSGHTGVDQYQKSQTL 467
LNDQGLILTNAHLLEPWRFGKTTV+G +G Q PE+ ++ VD ++K+Q L
Sbjct: 414 LNDQGLILTNAHLLEPWRFGKTTVNGGEDGTKLQDPFIPPEEFPR--YSEVDGHEKTQRL 471
Query: 468 PPKMPKIVDSSV-DEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSL 526
PPK I++SSV DE + YKLS +G IRVRLDH DPWIWCDAK+V+VCKGPLDV+L
Sbjct: 472 PPKTLNIMNSSVADESKGYKLSLSYKGPMNIRVRLDHADPWIWCDAKVVHVCKGPLDVAL 531
Query: 527 LQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSY 586
LQL ++PDQL P DF SLGS AYVIGHGLFGPRCG SPS+ SG V+KVVKA PSY
Sbjct: 532 LQLEHVPDQLFPTKVDFECSSLGSKAYVIGHGLFGPRCGFSPSICSGAVSKVVKAKAPSY 591
Query: 587 GQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTRY-------------FKL 633
QS S P MLETTAAVHPGGSGGAVVN +GHMIGLVT F +
Sbjct: 592 CQSVQGGYSHIPAMLETTAAVHPGGSGGAVVNSEGHMIGLVTSKARHGGGTVIPHLNFSI 651
Query: 634 SCLKMSKFMLVAKLLAQLSFL 654
C ++ AK + +S L
Sbjct: 652 PCAVLAPIFDFAKDMRDISLL 672
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224125536|ref|XP_002329829.1| predicted protein [Populus trichocarpa] gi|222870891|gb|EEF08022.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359483482|ref|XP_002273997.2| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal processing protease, glyoxysomal-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536763|ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297740411|emb|CBI30593.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356546634|ref|XP_003541729.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|357446685|ref|XP_003593618.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] gi|355482666|gb|AES63869.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297851284|ref|XP_002893523.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] gi|297339365|gb|EFH69782.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18086453|gb|AAL57680.1| At1g28320/F3H9_2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 675 | ||||||
| TAIR|locus:2032142 | 709 | DEG15 "degradation of periplas | 0.482 | 0.459 | 0.475 | 1.2e-138 | |
| DICTYBASE|DDB_G0279049 | 849 | DDB_G0279049 "trypsin-like ser | 0.115 | 0.091 | 0.417 | 1e-18 | |
| ZFIN|ZDB-GENE-030131-8525 | 565 | tysnd1 "trypsin domain contain | 0.170 | 0.203 | 0.363 | 8.5e-16 | |
| UNIPROTKB|Q2T9J0 | 566 | TYSND1 "Peroxisomal leader pep | 0.16 | 0.190 | 0.35 | 5.1e-13 | |
| UNIPROTKB|F1SUE6 | 568 | TYSND1 "Uncharacterized protei | 0.146 | 0.174 | 0.366 | 7.6e-11 | |
| RGD|1307354 | 567 | Tysnd1 "trypsin domain contain | 0.171 | 0.204 | 0.328 | 1.5e-10 | |
| MGI|MGI:1919017 | 568 | Tysnd1 "trypsin domain contain | 0.131 | 0.156 | 0.373 | 1.7e-10 | |
| UNIPROTKB|F1NN98 | 332 | TYSND1 "Uncharacterized protei | 0.082 | 0.168 | 0.491 | 7.4e-07 | |
| UNIPROTKB|F1P5W4 | 350 | TYSND1 "Uncharacterized protei | 0.082 | 0.16 | 0.491 | 9.4e-07 | |
| UNIPROTKB|E1BF31 | 565 | E1BF31 "Uncharacterized protei | 0.131 | 0.157 | 0.383 | 5.5e-06 |
| TAIR|locus:2032142 DEG15 "degradation of periplasmic proteins 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 725 (260.3 bits), Expect = 1.2e-138, Sum P(2) = 1.2e-138
Identities = 164/345 (47%), Positives = 213/345 (61%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFF-DTK 59
M + ++ FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG TLSASG+LLP F +
Sbjct: 1 MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60
Query: 60 VAERNWGVNGLIVTVASVVEPFLLPQYR-DKDTSEGQPELITGSQIDFLVEGKLRSEKEH 118
VA + G + + V + P TS I+ + + + E
Sbjct: 61 VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSS----ISQDPVKLIPGAMIEIMVEG 116
Query: 119 E-DVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPL 177
+ +K +P WV AQL+ LVD+PVSS ALQSL+EASSG + W++GWSL N SQP
Sbjct: 117 QLKSEKEAPFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGSQPS 176
Query: 178 MGVVKTSIESNKISLMESHRPFAXXXXXXXXXXXXXXXRVAILGVSSYLKDLPNIALTPL 237
+ +IE LM+ P R+AILGV L P++
Sbjct: 177 I-----NIEHYSKPLMQLDEPH------NANFMAKSATRMAILGVPLSLLGQPSMNFASS 225
Query: 238 NKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPV 297
+ +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP S +SL++AD+RCLPGMEG PV
Sbjct: 226 SSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEGAPV 285
Query: 298 FGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEP 341
F ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP
Sbjct: 286 FAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP 330
|
|
| DICTYBASE|DDB_G0279049 DDB_G0279049 "trypsin-like serine protease family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8525 tysnd1 "trypsin domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9J0 TYSND1 "Peroxisomal leader peptide-processing protease" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUE6 TYSND1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1307354 Tysnd1 "trypsin domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919017 Tysnd1 "trypsin domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NN98 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5W4 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF31 E1BF31 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8VZD4 | DEG15_ARATH | 3, ., 4, ., 2, 1, ., - | 0.5257 | 0.8637 | 0.8222 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 675 | |||
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 4e-08 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 2e-05 | |
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 2e-04 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 0.001 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 0.003 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 0.003 |
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Score = 52.2 bits (125), Expect = 4e-08
Identities = 29/117 (24%), Positives = 44/117 (37%), Gaps = 15/117 (12%)
Query: 510 CDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPS 569
A++V LD++LL++ P+ A P GS V G G G
Sbjct: 37 VPAEVVAADPD-LDLALLKVDGPLLPAAPLLASSAAPLGGSVVVVGGPGGIGLGASGGGG 95
Query: 570 VSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGL 626
G+V+ + Y + T A PG SGG V + DG ++G+
Sbjct: 96 GVGGLVSGSLGGVDGRY--------------ILTDADTSPGSSGGPVFDADGEVVGI 138
|
This family includes trypsin like peptidase domains. Length = 138 |
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 675 | |||
| PRK10898 | 353 | serine endoprotease; Provisional | 99.92 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.92 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.92 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.9 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.89 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.84 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.79 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.78 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.77 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.74 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.72 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.7 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.5 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.38 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.28 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.21 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 99.2 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.2 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 98.54 | |
| KOG3627 | 256 | consensus Trypsin [Amino acid transport and metabo | 98.52 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.22 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 97.7 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 97.67 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 97.65 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 97.28 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 97.14 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 96.35 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 93.81 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 93.15 | |
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 92.41 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 91.85 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 91.07 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 90.28 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 89.24 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 89.09 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 87.9 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 86.95 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 86.28 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 85.68 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 84.7 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 83.29 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 80.39 |
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=99.92 E-value=4.4e-24 Score=231.05 Aligned_cols=186 Identities=24% Similarity=0.350 Sum_probs=144.7
Q ss_pred hhHhhccCceEEEEeCC-----------CeeEEEEEEeCCcEEEEcccccCCCCCcceeccCCCcccccCCCCCCCCCCC
Q 005822 388 LPIQKALASVCLITIDD-----------GVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHT 456 (675)
Q Consensus 388 ~~ie~a~~SVV~I~~~~-----------~~wGSGvlIn~~GlILTnAHVV~p~~~g~~~~~g~~~~~~~~~~~~~~~~~~ 456 (675)
..++++.|+||.|.... ..+||||+|+++||||||+||++. .
T Consensus 49 ~~~~~~~psvV~v~~~~~~~~~~~~~~~~~~GSGfvi~~~G~IlTn~HVv~~---------a------------------ 101 (353)
T PRK10898 49 QAVRRAAPAVVNVYNRSLNSTSHNQLEIRTLGSGVIMDQRGYILTNKHVIND---------A------------------ 101 (353)
T ss_pred HHHHHhCCcEEEEEeEeccccCcccccccceeeEEEEeCCeEEEecccEeCC---------C------------------
Confidence 56889999999997621 158999999999999999999961 1
Q ss_pred cccccccccCCCCCCCcccccccccccceeeeeeecCceEEEEEEecCCCCceeeeEEEEecCCCCCeEEEEecCCCCCc
Q 005822 457 GVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQL 536 (675)
Q Consensus 457 ~v~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vrl~~~~~~~w~~a~vv~~~~~~~DIALLkL~~~~~~l 536 (675)
..+.|++..+.. |.|++++.++. +||||||++. ..+
T Consensus 102 --------------------------------------~~i~V~~~dg~~---~~a~vv~~d~~-~DlAvl~v~~--~~l 137 (353)
T PRK10898 102 --------------------------------------DQIIVALQDGRV---FEALLVGSDSL-TDLAVLKINA--TNL 137 (353)
T ss_pred --------------------------------------CEEEEEeCCCCE---EEEEEEEEcCC-CCEEEEEEcC--CCC
Confidence 124455444333 88999998886 9999999985 356
Q ss_pred ceeeCCCCC-CCCCCeEEEEecCCCCCCCCCCCceeeeEEeeeEEecCCccCcccccCCCCcceEEEEcccccCCccccc
Q 005822 537 CPIDADFGQ-PSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGA 615 (675)
Q Consensus 537 ~PI~l~~~~-~~~G~~V~ViG~glfg~~~g~~pSvs~GiIs~v~~~~~~~~~~~~~~~~~~~~~~lqTda~v~~G~SGGP 615 (675)
+++.+.+.. +++|+.|+++|||. +...+++.|+|+...+..... .....++|||+++++|+||||
T Consensus 138 ~~~~l~~~~~~~~G~~V~aiG~P~-----g~~~~~t~Giis~~~r~~~~~---------~~~~~~iqtda~i~~GnSGGP 203 (353)
T PRK10898 138 PVIPINPKRVPHIGDVVLAIGNPY-----NLGQTITQGIISATGRIGLSP---------TGRQNFLQTDASINHGNSGGA 203 (353)
T ss_pred CeeeccCcCcCCCCCEEEEEeCCC-----CcCCCcceeEEEeccccccCC---------ccccceEEeccccCCCCCcce
Confidence 777886554 89999999999984 455788999999876532110 112357999999999999999
Q ss_pred eecCCceEEEEEeeeeeCCCc----eeEEEeehHHHHHHHHHHHHhh
Q 005822 616 VVNLDGHMIGLVTRYFKLSCL----KMSKFMLVAKLLAQLSFLFFIF 658 (675)
Q Consensus 616 Lvd~~G~LIGIVssnak~~~~----~~i~f~ip~~~l~~l~~~~~~~ 658 (675)
|+|.+|+||||+++....... ..++|+||++++...+..++.+
T Consensus 204 l~n~~G~vvGI~~~~~~~~~~~~~~~g~~faIP~~~~~~~~~~l~~~ 250 (353)
T PRK10898 204 LVNSLGELMGINTLSFDKSNDGETPEGIGFAIPTQLATKIMDKLIRD 250 (353)
T ss_pred EECCCCeEEEEEEEEecccCCCCcccceEEEEchHHHHHHHHHHhhc
Confidence 999999999999876544321 4599999999999998887654
|
|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3627 consensus Trypsin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 68.0 bits (165), Expect = 7e-12
Identities = 81/609 (13%), Positives = 184/609 (30%), Gaps = 160/609 (26%)
Query: 57 DTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK----- 111
D + E + ++ SV E + + KD + +++ +ID ++ K
Sbjct: 8 DFETGEHQYQYKDIL----SVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63
Query: 112 -------LRSEKEH------EDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPE 158
L S++E E+V + + +++ + + P S+ + +E L
Sbjct: 64 TLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP--SMMTRMYIEQRDRL-- 119
Query: 159 HEWEVGWSLAPYNNSSQPLMGVVKTSIE---------------SNKISLMESHRPFAMEE 203
+ A YN S ++ ++ S K + A++
Sbjct: 120 --YNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWV-------ALDV 170
Query: 204 SSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVL-----SPMH 258
+ + K ++ L + + P L L K LL + + +
Sbjct: 171 CLSYKVQCKMDFKIFWLNLKNCNS--PETVLEMLQK---LLYQIDPNWTSRSDHSSNIKL 225
Query: 259 FFNSVSMGSVANCYPPRSTTRSLLMAD------------IRC--------------LPGM 292
+S+ + + LL+ + C L
Sbjct: 226 RIHSIQ-AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAA 284
Query: 293 EGGPVFGEH--------------AHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL 338
+ +H ++ + L + E+ P ++ ++ +
Sbjct: 285 TTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPR-RLSI-IAESIR 338
Query: 339 KEPQNAEKEIHINKGNLN-AVGNSL-LFNSHILNGACCYKY-----EHVDSRCRSPLPIQ 391
+ H+N L + +SL + + +P
Sbjct: 339 DGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRK--MFDRLSVFPPSA------HIPTI 390
Query: 392 KALASVCLITIDDGVWASGVLLNDQGLILTNAH---LLEPWRFGKTTVSGWRNGVSF--- 445
L+++ +W + +D +++ H L+E ++T+S +
Sbjct: 391 -------LLSL---IWFDVIK-SDVMVVVNKLHKYSLVEKQPK-ESTIS--IPSIYLELK 436
Query: 446 QPEDSASSGH-TGVDQYQKSQTLPP--KMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLD 502
++ + H + VD Y +T +P +D H + L + R R+
Sbjct: 437 VKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV 496
Query: 503 HLD-PWIWCDAKIVYV-----CKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIG 556
LD ++ + KI + G + +L QL + +C D + + V
Sbjct: 497 FLDFRFL--EQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYER-------LVNA 547
Query: 557 HGLFGPRCG 565
F P+
Sbjct: 548 ILDFLPKIE 556
|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 675 | |||
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.94 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.93 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.93 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.93 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.92 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.92 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.92 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.91 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.91 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.91 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.91 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.9 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.9 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.89 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.89 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.79 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.77 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.75 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.74 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.74 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.74 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.74 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.73 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.73 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.73 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.71 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.69 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.68 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.64 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.64 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.63 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.63 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.63 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.63 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.59 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.57 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.57 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.55 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.54 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.51 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.5 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.5 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.49 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.49 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.49 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.49 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.49 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.49 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.48 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.48 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.48 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.48 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.47 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.47 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.46 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.46 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.46 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.46 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.46 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.46 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.46 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.46 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.45 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.45 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.45 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.45 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.43 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.43 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.43 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.43 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.43 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.43 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.43 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.42 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.42 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.42 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.42 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.41 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.41 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.41 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.41 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.41 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.41 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.41 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.41 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.4 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.4 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.4 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.4 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.4 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.39 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.38 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.37 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.35 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.35 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.35 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.35 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.34 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.34 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.34 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.34 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.33 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.33 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.33 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.33 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.33 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.32 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.32 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.32 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.32 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.32 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.29 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.29 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.28 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.27 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.27 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.26 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.26 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.25 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.24 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.23 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 99.22 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.21 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 99.21 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 99.2 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.2 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.19 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.19 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.18 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.17 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.16 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 99.16 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 99.14 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.14 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.14 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 99.11 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.11 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 99.08 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 99.07 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 99.05 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.02 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 98.99 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.98 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 98.97 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 98.96 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 98.93 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 98.93 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 98.9 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.86 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.84 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 98.81 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 98.78 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 98.69 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.66 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.59 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.5 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.45 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.43 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.39 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.38 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 98.09 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 97.64 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 97.56 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 97.5 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 96.84 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 94.92 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 94.62 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 94.46 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 94.35 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 94.18 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 93.53 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 93.32 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 93.27 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 93.25 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 93.17 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 92.81 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 92.53 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 92.47 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 91.83 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 91.82 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 91.52 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 91.5 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 91.35 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 91.29 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 91.26 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 91.12 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 90.97 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 90.95 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 90.92 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 90.63 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 90.57 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 90.55 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 90.44 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 90.42 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 90.37 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 90.33 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 89.86 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 89.86 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 89.85 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 89.55 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 89.34 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 89.31 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 89.29 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 89.23 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 89.19 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 88.85 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 88.83 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 88.71 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 88.71 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 88.68 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 88.65 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 88.37 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 88.25 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 88.2 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 87.77 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 87.72 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 87.72 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 87.3 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 87.25 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 87.15 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 87.05 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 86.94 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 86.94 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 86.51 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 86.25 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 86.11 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 86.03 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 86.02 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 86.02 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 86.02 | |
| 4ash_A | 185 | NS6 protease; hydrolase, trypsin-like, calicivirus | 85.71 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 85.69 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 85.63 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 85.42 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 85.4 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 85.34 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 85.2 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 84.76 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 84.61 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 84.17 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 84.02 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 83.32 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 83.3 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 83.21 | |
| 1ep5_B | 157 | Capsid protein C, coat protein C; beta barrel, hyd | 83.05 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 82.91 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 82.74 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 82.2 | |
| 1vcp_A | 149 | Semliki forest virus capsid protein; virus coat pr | 82.1 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 81.85 | |
| 4agk_A | 158 | Capsid protein, coat protein, C; hydrolase, viral | 81.79 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 81.7 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 81.7 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 81.64 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 81.24 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 80.02 |
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.94 E-value=3.3e-26 Score=234.42 Aligned_cols=189 Identities=26% Similarity=0.405 Sum_probs=140.4
Q ss_pred hhHhhccCceEEEEeCC----------------------------CeeEEEEEEeCC-cEEEEcccccCCCCCcceeccC
Q 005822 388 LPIQKALASVCLITIDD----------------------------GVWASGVLLNDQ-GLILTNAHLLEPWRFGKTTVSG 438 (675)
Q Consensus 388 ~~ie~a~~SVV~I~~~~----------------------------~~wGSGvlIn~~-GlILTnAHVV~p~~~g~~~~~g 438 (675)
..++++.||||.|.... ...||||+|+++ ||||||+||++..
T Consensus 17 ~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfiI~~~~G~IlTnaHvv~~a--------- 87 (245)
T 3sti_A 17 PMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVINQA--------- 87 (245)
T ss_dssp HHHHHHGGGEEEC----------------------------------CCEEEEEETTTTEEEECGGGC------------
T ss_pred HHHHHhCCceEEEEEEEeeccccccchhhhhhccccccccccccccceEEEEEEeCCCCEEEEcHHHhCCC---------
Confidence 57899999999997521 357999999998 9999999999610
Q ss_pred CCcccccCCCCCCCCCCCcccccccccCCCCCCCcccccccccccceeeeeeecCceEEEEEEecCCCCceeeeEEEEec
Q 005822 439 WRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVC 518 (675)
Q Consensus 439 ~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vrl~~~~~~~w~~a~vv~~~ 518 (675)
. .++|++..+. ++.++++..+
T Consensus 88 -~-------------------------------------------------------~i~V~~~dg~---~~~a~vv~~d 108 (245)
T 3sti_A 88 -Q-------------------------------------------------------KISIQLNDGR---EFDAKLIGSD 108 (245)
T ss_dssp ---------------------------------------------------------CEEEECTTSC---EEEEEEEEEE
T ss_pred -C-------------------------------------------------------EEEEEECCCC---EEEEEEEEec
Confidence 0 1333332222 3788888887
Q ss_pred CCCCCeEEEEecCCCCCcceeeCCCC-CCCCCCeEEEEecCCCCCCCCCCCceeeeEEeeeEEecCCccCcccccCCCCc
Q 005822 519 KGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAY 597 (675)
Q Consensus 519 ~~~~DIALLkL~~~~~~l~PI~l~~~-~~~~G~~V~ViG~glfg~~~g~~pSvs~GiIs~v~~~~~~~~~~~~~~~~~~~ 597 (675)
.. +||||||++. +..++++.+.+. .++.|+.|+++||| .+...+++.|+|+...+... ....+
T Consensus 109 ~~-~DlAlLkv~~-~~~~~~~~l~~s~~~~~G~~v~aiG~P-----~g~~~~vt~G~vs~~~~~~~---------~~~~~ 172 (245)
T 3sti_A 109 DQ-SDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGNP-----FGLGQTATSGIVSALGRSGL---------NLEGL 172 (245)
T ss_dssp TT-TTEEEEEESS-CCSCCCCCBCCGGGCCTTBEEEEEECG-----GGSCCEEEEEEEEECSSCSS---------CCTTC
T ss_pred CC-CCEEEEEecc-CCCCceeeecCcCCCCCCCEEEEEECC-----CCCCCcEEeeEEeeeccccc---------CCCCc
Confidence 75 9999999975 567888888754 58999999999997 35567899999987754210 01223
Q ss_pred ceEEEEcccccCCccccceecCCceEEEEEeeeeeCCCc-eeEEEeehHHHHHHHHHHHHhhhh
Q 005822 598 PVMLETTAAVHPGGSGGAVVNLDGHMIGLVTRYFKLSCL-KMSKFMLVAKLLAQLSFLFFIFLI 660 (675)
Q Consensus 598 ~~~lqTda~v~~G~SGGPLvd~~G~LIGIVssnak~~~~-~~i~f~ip~~~l~~l~~~~~~~~~ 660 (675)
..++++++++++|+|||||||.+|+||||+++......+ ..++|+||+..+..++..++.+..
T Consensus 173 ~~~i~tda~i~~G~SGGPLvn~~G~vVGI~s~~~~~~~~~~g~~faIP~~~~~~~~~~l~~~g~ 236 (245)
T 3sti_A 173 ENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGE 236 (245)
T ss_dssp SSCEEESSCCCTTTTTSEEECTTSCEEEEEECCC------CCCEEEEEHHHHHHHHHHHHHHHH
T ss_pred cCEEEEcCCcCCCcchhHeecCCCeEEEEEEeEECCCCCcceEEEEEeHHHHHHHHHHHHHcCC
Confidence 456999999999999999999999999999987654433 458999999999999999887654
|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 675 | ||||
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 1e-07 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 0.003 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 5e-07 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 5e-06 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 1e-05 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 3e-04 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 4e-04 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 0.001 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Score = 50.7 bits (120), Expect = 1e-07
Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 15/128 (11%)
Query: 505 DPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPID-ADFGQPSLGSAAYVIGHGLFGPR 563
V K P L P L I AD +G IG+
Sbjct: 106 QLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFG--- 162
Query: 564 CGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHM 623
L +V+SG+V+ + ++ L + ++T AA++ G +GGA+VNL+G +
Sbjct: 163 --LGETVTSGIVSALGRSGLNAENYENF---------IQTDAAINRGNAGGALVNLNGEL 211
Query: 624 IGLVTRYF 631
IG+ T
Sbjct: 212 IGINTAIL 219
|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 675 | |||
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.93 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.93 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.93 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.92 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.91 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.83 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.78 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.72 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.67 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.61 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.58 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.58 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.56 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.56 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.48 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.48 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.38 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.34 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.3 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.26 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.25 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.25 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 99.24 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.24 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.22 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 99.21 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.21 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.21 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 99.19 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 99.18 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.18 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 99.17 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 99.15 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 99.15 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 99.15 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 99.14 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.13 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 99.12 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 99.12 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 99.12 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 99.11 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 99.1 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 99.1 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 99.1 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.07 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 99.06 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.05 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 99.04 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 99.02 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 99.01 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 99.01 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 99.0 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.98 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.98 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 98.98 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 98.97 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 98.96 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 98.92 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.91 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.9 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 98.9 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 98.89 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.89 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 98.88 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.85 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 98.85 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 98.83 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 98.8 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.78 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.77 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 98.76 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 98.75 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 98.72 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.61 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 98.49 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 98.38 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 98.12 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 97.66 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 97.24 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 96.92 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 96.11 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 95.98 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 90.27 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 87.85 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 84.55 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 84.52 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 83.23 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 81.72 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 81.1 |
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Thermotoga maritima [TaxId: 2336]
Probab=99.93 E-value=3.8e-26 Score=228.32 Aligned_cols=189 Identities=21% Similarity=0.295 Sum_probs=142.7
Q ss_pred hhHhhccCceEEEEeCC------------------------------CeeEEEEEEeCCcEEEEcccccCCCCCcceecc
Q 005822 388 LPIQKALASVCLITIDD------------------------------GVWASGVLLNDQGLILTNAHLLEPWRFGKTTVS 437 (675)
Q Consensus 388 ~~ie~a~~SVV~I~~~~------------------------------~~wGSGvlIn~~GlILTnAHVV~p~~~g~~~~~ 437 (675)
+.++++.||||+|.... .++||||+|+++||||||+||++...
T Consensus 8 ~~v~~~~psVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~GSGfiI~~~G~IlTn~HVv~~~~------- 80 (228)
T d1l1ja_ 8 NVVEACAPAVVKIDVVKTVKTSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGAD------- 80 (228)
T ss_dssp HHHHHHGGGEEEEEEECC--CCCCCHHHHHHHHHHCTTSCTTHHHHEEEEEEEEEEETTTEEEEEHHHHSSCS-------
T ss_pred HHHHHhCCcEEEEEEEEEEecCCCCchhhHhhhhhccccCCccccccccceEEEEeecCceEEeecccccccc-------
Confidence 57899999999997621 24799999999999999999997321
Q ss_pred CCCcccccCCCCCCCCCCCcccccccccCCCCCCCcccccccccccceeeeeeecCceEEEEEEecCCCCceeeeEEEEe
Q 005822 438 GWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYV 517 (675)
Q Consensus 438 g~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vrl~~~~~~~w~~a~vv~~ 517 (675)
. ..+...+++ ++.|+++..
T Consensus 81 --~----------------------------------------------~~v~~~~~~-------------~~~a~v~~~ 99 (228)
T d1l1ja_ 81 --N----------------------------------------------ITVTMLDGS-------------KYDAEYIGG 99 (228)
T ss_dssp --S----------------------------------------------CEEECTTSC-------------EEEBCCCEE
T ss_pred --c----------------------------------------------ceEEeecce-------------eEeEEEeee
Confidence 0 011111221 266788777
Q ss_pred cCCCCCeEEEEecCCCCCcceeeCCCC-CCCCCCeEEEEecCCCCCCCCCCCceeeeEEeeeEEecCCccCcccccCCCC
Q 005822 518 CKGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSA 596 (675)
Q Consensus 518 ~~~~~DIALLkL~~~~~~l~PI~l~~~-~~~~G~~V~ViG~glfg~~~g~~pSvs~GiIs~v~~~~~~~~~~~~~~~~~~ 596 (675)
++. .|+|+|+++..+..++++++... .++.|+.|+++|||. +...+.+.+.+....+...... ....
T Consensus 100 ~~~-~dlall~v~~~~~~~~~l~l~~s~~~~~G~~V~aiG~P~-----g~~~~~~~~~~~~~~~~~~~~~------~~~~ 167 (228)
T d1l1ja_ 100 DEE-LDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPL-----GFQHTVTVGVVSATNRRIPKPD------GSGY 167 (228)
T ss_dssp ETT-TTEEEEEBCCSSSCCCCCEECCGGGCCTTCEEEEEECTT-----SSSCEEEEEEEEEEEEEEECTT------SSCE
T ss_pred ccc-ccceeeEeecCCCCCceEEccCccccccCCcEEEEECCC-----CCCCceEeeeeecccccccccc------CcCc
Confidence 775 99999999875667888998764 589999999999984 5557778887776654321110 1122
Q ss_pred cceEEEEcccccCCccccceecCCceEEEEEeeeeeCCCceeEEEeehHHHHHHHHHHHH
Q 005822 597 YPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTRYFKLSCLKMSKFMLVAKLLAQLSFLFF 656 (675)
Q Consensus 597 ~~~~lqTda~v~~G~SGGPLvd~~G~LIGIVssnak~~~~~~i~f~ip~~~l~~l~~~~~ 656 (675)
...++++|+++.+|+|||||||.+|+||||+++.........++|+||+..+.+++..++
T Consensus 168 ~~~~~~~da~i~~G~SGGPl~n~~G~VIGI~~~~~~~~~~~~i~faIp~~~i~~~l~~l~ 227 (228)
T d1l1ja_ 168 YVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTIL 227 (228)
T ss_dssp EEEEEEESSCCCTTTTTSEEECSSSEEEEEECCCSCCCSCCSCEEEEEHHHHHHHHGGGC
T ss_pred ccceeEEecccCCCCCCCcEECCCCEEEEEEEEEecCCCCCCEEEEEEHHHHHHHHHHhc
Confidence 345799999999999999999999999999988766665666999999999999987654
|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|