Citrus Sinensis ID: 005864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---
MNHLSGAIPPSVGNFTNLKGLYLYSNSLSGSVPGEIGNLMQLTNLEIDNNQLFGQIPRSLRNLASLNRVHLEQNHLTGNISEVFGIYPNLTFLDISHNNFYGEIWSSWGKCQQLGTLNFSMNNITGSIPPEIGKLYQLHKLDFSLNQIVGEIPIELGNLKSLNYLVLNGNKLSGNLPRVLGSLSELEYLDLSTNKLSGSIPETLGNLLKVHYLNLSNNQFRKEFPVELEKLVQLSELDLSHNFLGGEIPPQICNLESLEKLNVSHNNLSGLIPSCFEGMHGLSCIDISYNELLGLIPNSTGFQYDPIQALRGNRGLCGDVEGFQSCKAFVSQKHVFENKWFLIIIPILGVFALLFFVIGIIFGRTKRTSKENKGSCENHRGLLSILTFEGKIVYEEIIRATKNFDAEQCIGIGGQASVYRGELPSGEVVAVKKFHSLLLSEISVQREFLNEIKALTEIRHRNIVKFYGFCSHPRHSFLVYECLERGSLAEILSNDGSIKEFSWIVRTNVIKSVANALSYMHHDCFPPIVHRDISSKNVLLSSEYEARVSDFGIAKFLKPGSSNWTEFAGTFGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISLLSSSSSNMNLSLNEILDPRLPLPSRNIQDKLISILEVALLCLEESPESRPTMQTVCQLLCK
ccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccCEcccccccccccccccEEEccccCEEEcccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccHHccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccCEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHHcccccccccHHHHECcccccEEEEccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHc
MNHLSGAIPPSVGNFTNLKGLYLYSNSLSGSVPGEIGNLMQLTNLEIDNNQLFGQIPRSLRNLASLNRVHLEQNHLTGNISEVFGIYPNLTFLDISHNNFYGEIWSSWGKCQQLGTLNFSMNNITGSIPPEIGKLYQLHKLDFSLNQIVGEIPIELGNLKSLNYLVLNGNKLSGNLPRVLGSLSELEYLDLSTNKLSGSIPETLGNLLKVHYLNLSNNQFRKEFPVELEKLVQLSELDLSHNFLGGEIPPQICNLESLEKLNVSHNNLSGLIPSCFEGMHGLSCIDISYNELLGLIPNSTGFQYDPIQALRGNRGLCGDVEGFQSCKAFVSQKHVFENKWFLIIIPILGVFALLFFVIGIIFGRTK*************RGLLSILTFEGKIVYEEIIRATKNFDAEQCIGIGGQASVYRGELPSGEVVAVKKFHSLLLSEISVQREFLNEIKALTEIRHRNIVKFYGFCSHPRHSFLVYECLERGSLAEILSNDGSIKEFSWIVRTNVIKSVANALSYMHHDCFPPIVHRDISSKNVLLSSEYEARVSDFGIAKFLKPGSSNWTEFAGTFGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISLLSSSSSNMNLSLNEILDPRLPLPSRNIQDKLISILEVALLCLEESPESRP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHLSGAIPPSVGNFTNLKGLYLYSNSLSGSVPGEIGNLMQLTNLEIDNNQLFGQIPRSLRNLASLNRVHLEQNHLTGNISEVFGIYPNLTFLDISHNNFYGEIWSSWGKCQQLGTLNFSMNNITGSIPPEIGKLYQLHKLDFSLNQIVGEIPIELGNLKSLNYLVLNGNKLSGNLPRVLGSLSELEYLDLSTNKLSGSIPETLGNLLKVHYLNLSNNQFRKEFPVELEKLVQLSELDLSHNFLGGEIPPQICNLESLEKLNVSHNNLSGLIPSCFEGMHGLSCIDISYNELLGLIPNSTGFQYDPIQALRGNRGLCGDVEGFQSCKAFVSQKHVFENKWFLIIIPILGVFALLFFVIGIIFGRTKRTSKENKGSCENHRGLLSILTFEGKIVYEEIIRATKNFDAEQCIGIGGQASVYRGELPSGEVVAVKKFHSLLLSEISVQREFLNEIKALTEIRHRNIVKFYGFCSHPRHSFLVYECLERGSLAEILSNDGSIKEFSWIVRTNVIKSVANALSYMHHDCFPPIVHRDISSKNVLLSSEYEARVSDFGIAKFLKPGSSNWTEFAGTFGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISLLSSSSSNMNLSLNEILDPRLPLPSRNIQDKLISILEVALLCLEESPESRPTMQTVCQLLCK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At4g08850 probableQ8VZG8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A79, chain B
Confidence level:very confident
Coverage over the Query: 2-315
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 2-329
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 498-672
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 390-673
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 343-367
View the alignment between query and template
View the model in PyMOL