Citrus Sinensis ID: 005896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE
ccccccccccccccHHHHHHHHHHHHHccccccEEccccccEEEEcHHHHHHHHHHHHccEEEEEccccccccccccEEEEEEEcccccccccHHHcccccccccccccccccccccccccHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccccccEEEccccccccHHHcccccccccEEEEccccccccHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHccccccccccEEEEccccccccccccccccccEEEEEECcccccccccccccccccccEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccccccEEccccccccccccccccccccEEEEECcccccccccccccccEEECcccccEEEEccccccccccccccccccccEEEEECccccCECccccccccccEEEEEccccccccHHHHccccccccEEEECcccccccccccccccccccccccEEEECccccccccccccccccccccEEEECccccccccccccccccccEEEECccccHHHHHcccccccccccccccEEEEccCEEEccccc
************ERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSD*****VLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 155-245,277-288,307-443
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 132-228,276-298,309-384
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 100-242,273-282,310-448,460-478,489-635
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 75-110
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 75-645
View the alignment between query and template
View the model in PyMOL
Template: 4G8A, chain A
Confidence level:confident
Coverage over the Query: 101-669
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:confident
Coverage over the Query: 1-62
View the alignment between query and template
View the model in PyMOL