Citrus Sinensis ID: 005896

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE
ccccccccccccccHHHHHHHHHHHHHccccccEEccccccEEEEcHHHHHHHHHHHHccEEEEEccccccccccccEEEEEEEcccccccccHHHcccccccccccccccccccccccccHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccccccEEEccccccccHHHcccccccccEEEEccccccccHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHccccccccccEEEEccccccccccccccccccEEEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccccccEEccccccccccccccccccccEEEEEEcccccccccccccccEEEEcccccEEEEccccccccccccccccccccEEEEEEccccEEEccccccccccEEEEEccccccccHHHHccccccccEEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccHHHHHcccccccccccccccEEEEccEEEEccccc
ccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEEEEccccccccccHHHHHHcHHHEccccccccccccccccccccHHHHHHHcccEEEEEEccccccccccccccccccEEEEccccccccccccccccHHHHEEEHcccccHHccccccccccccEEEEcccccccEcccccccccccccEEEEEEEccccccccHHHHHcHHHcccEEEEccccccccHHHHHHHcHcccccccEEEEEEcccccccccHHHHHHHHHHccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccHcEEEEcccccEEEccHHHcccccccccccHcEEEEcccHcHHccccccccccccccccccEEEEEccccHHcccccccccccEEEEEcccccccccccccccccEEEccccccEEEEcccccHccccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHccccHHcccccccccEEEEcccccHccccccccccccccccccEEEEcccccHccccHHcccccccHcEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcccEEEccccc
maggiirqsrskerledwgskcfhdLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRfervrhssyacggrdgkNMFEVFNEIGhlrtflplrlrirggsntsYITRSVLSDLLPMFKMLRMLSLqgyrigelpipfedLRLLRFLNLadtdirslpeskcKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLsnfivgkgecasgledlkSLNLLCDELCIAglenvnspqNAREAALREKHNLEAltlewgsqsdsprdaVLEEKVLDTLQPHERIKELAIKHyggarfppwigqhsfsemkvlklencdncaalpslglmSSLKILAVKGLKKLKSIEsevygegfsmpfpsleilsfeslpewqhwntnikgnepveifprlqelsiaecpqlsgelpgllpsletlvvrkcgklvvplssypmlcrlevDECKELVdicgcdklealpndmhKLNSLRDlgiqlcpnlvsfpeegfptnlttLVIGNFKLYKTLVQWGLHRLTSLKHLWiavsddeaecfpdeeigmtlptslthlsfcgfqNLIFLssmgfqnltslqylrigncpnltsfpevglpssllelhiygcpnlkkackrdqgkewpkiahipfvgidrkfiydpeae
maggiirqsrskerledWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEantlsrrfervrhssyacggrdgKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALtlewgsqsdsprDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGkewpkiahipfvgidrkFIYDPEAE
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQlsgelpgllpsleTLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE
****************DWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENV***************************************VLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIY*****
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANT**RRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSD*****VLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYD****
***************EDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE
************ERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGETIFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAALPSLGLMSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYDPEAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query671 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.763 0.485 0.356 4e-79
Q9LRR5 1424 Putative disease resistan no no 0.660 0.311 0.388 1e-70
Q7XA39988 Putative disease resistan N/A no 0.810 0.550 0.313 1e-51
Q7XBQ9970 Disease resistance protei N/A no 0.742 0.513 0.323 7e-49
Q7XA42979 Putative disease resistan N/A no 0.801 0.549 0.299 4e-45
Q7XA40992 Putative disease resistan N/A no 0.804 0.544 0.285 1e-40
O81825919 Probable disease resistan no no 0.529 0.386 0.263 4e-08
Q9T048985 Disease resistance protei no no 0.523 0.356 0.256 5e-07
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.512 0.335 0.261 1e-06
P0CB16 1201 Putative disease resistan no no 0.508 0.283 0.266 3e-06
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  296 bits (758), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 203/570 (35%), Positives = 297/570 (52%), Gaps = 58/570 (10%)

Query: 1    MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGET 60
            MA G ++Q+RS + LE+ G++ F +L SRS+ Q+T      +++MHD I++LA+  SGE 
Sbjct: 452  MAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKT----KTRYIMHDFINELAQFASGEF 507

Query: 61   IFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSY 120
              + E+   L    ER R+ SY          FE   E+  LRTFLPL L     S +  
Sbjct: 508  SSKFEDGCKLQVS-ERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLT--NSSRSCC 564

Query: 121  ITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPF-EDLRLLRFLNLADTDIRSLPESKCKL 179
            + + V   LLP    LR+LSL  Y+I  LP  F +++   RFL+L+ T++  LP+S C +
Sbjct: 565  LDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYM 624

Query: 180  LNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVG 239
             NL+ L+L  CS L +LP ++ NLINLR+LD+ G KL ++MP     L  LQTL+ F V 
Sbjct: 625  YNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKL-RQMPRRFGRLKSLQTLTTFFVS 683

Query: 240  KGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDS- 298
              +  S + +L  L+ L  +L I  L+ V    +A EA L  K +L  +   W + S S 
Sbjct: 684  ASD-GSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSS 742

Query: 299  -----PRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDN 353
                 P     E +V + L+PH  I++LAI+ Y G RFP W+   SFS +  ++L  C  
Sbjct: 743  ENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQY 802

Query: 354  CAALPSLGLMSSLKILAVKGLKKLKSIESEVY------GEGFSMPFPSLEILSFESLPEW 407
            C +LPSLG +  LK L + G+  L+SI  + Y       +    PF SLE L F++LP+W
Sbjct: 803  CTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDW 862

Query: 408  QHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKL-------- 459
            Q W  +++     ++FP L++L I  CP+L+G LP  LPSL +L + KCG L        
Sbjct: 863  QEW-LDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFLPSLISLHIYKCGLLDFQPDHHE 920

Query: 460  -------------------VVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLN 500
                                 PL+ +  L +LEVD+C  L        LE     +   N
Sbjct: 921  YSYRNLQTLSIKSSCDTLVKFPLNHFANLDKLEVDQCTSLYS------LELSNEHLRGPN 974

Query: 501  SLRDLGIQLCPNLVSFPE-EGFPTNLTTLV 529
            +LR+L I  C NL   P+    P NL   +
Sbjct: 975  ALRNLRINDCQNLQLLPKLNALPQNLQVTI 1004
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
297736335 2534 unnamed protein product [Vitis vinifera] 0.977 0.258 0.402 1e-120
296090374 908 unnamed protein product [Vitis vinifera] 0.916 0.677 0.416 1e-116
359487172 1310 PREDICTED: putative disease resistance R 0.925 0.474 0.425 1e-114
147766792 2277 hypothetical protein VITISV_039904 [Viti 0.925 0.272 0.424 1e-113
359487176 1308 PREDICTED: putative disease resistance R 0.940 0.482 0.403 1e-112
359495024 1390 PREDICTED: putative disease resistance p 0.931 0.449 0.400 1e-111
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.935 0.446 0.399 1e-111
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.941 0.443 0.386 1e-111
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.913 0.278 0.416 1e-109
225465831 1483 PREDICTED: putative disease resistance R 0.931 0.421 0.392 1e-108
>gi|297736335|emb|CBI24973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  440 bits (1131), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 290/720 (40%), Positives = 397/720 (55%), Gaps = 64/720 (8%)

Query: 1    MAGGIIRQSRS-KERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGE 59
            MA G+I+Q  +  + +ED G   F +L+SRS FQ +  +D  +FVMHDLI DLA + SGE
Sbjct: 1825 MAEGLIQQPNADSQTMEDLGDNYFCELLSRSFFQSSG-NDESRFVMHDLICDLARVASGE 1883

Query: 60   TIFRLE---EANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGS 116
              F LE   E+N  S   +  RHSS+  G  D    FE F E  HLRTF+ L   I G  
Sbjct: 1884 ISFCLEDNLESNHRSTISKETRHSSFIRGKFDVFKKFEAFQEFEHLRTFVALP--IHGTF 1941

Query: 117  NTSYITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESK 176
              S++T  V   L+P F+ LR+LSL  Y I ELP     L+ LR+LNL+ T I+ LP+S 
Sbjct: 1942 TKSFVTSLVCDRLVPKFRQLRVLSLSEYMIFELPDSIGGLKHLRYLNLSFTQIKLLPDSV 2001

Query: 177  CKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNF 236
              L NL+ LIL NC  L +LP ++ NLI+LRHL++ G  L ++MP  + +L KLQTLS+F
Sbjct: 2002 TNLYNLQTLILSNCKHLTRLPSKIGNLISLRHLNVVGCSL-QDMPQQIGKLKKLQTLSDF 2060

Query: 237  IVGKGECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQS 296
            IV K     G+++LK L+ L  E+CI+ LENV   Q+AR+A L+ K N+E L++ W  + 
Sbjct: 2061 IVSK-RGFLGIKELKDLSHLRGEICISKLENVVDVQDARDANLKAKLNVERLSMIWSKEL 2119

Query: 297  DSPRDAVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNCAA 356
            D   D   E +VL +LQPH  +K+L I+ YGG +FP WI   S+ ++  L L  C  C +
Sbjct: 2120 DGSHDEDAEMEVLLSLQPHTSLKKLNIEGYGGRQFPNWICDPSYIKLVELSLIGCIRCIS 2179

Query: 357  LPSLGLMSSLKILAVKGLKKLKSIESEVYGEG--FSMPFPSLEILSFESLPEWQHWNTNI 414
            +PS+G +  LK L +K +  +KS+  E  G+    + PF  LE L FE + EW+ W  + 
Sbjct: 2180 VPSVGQLPFLKKLVIKRMDGVKSVGLEFEGQVSLHAKPFQCLESLWFEDMMEWEEWCWSK 2239

Query: 415  KGNEPVEIFPRLQELSIAECPQLSGELPGLLPSLETLVVRKCGKLVVPL-SSYPMLCRLE 473
            K       F  L +L I  CP+L  +LP  L SL  L +  C +++VPL +  P L  L 
Sbjct: 2240 KS------FSCLHQLEIKNCPRLIKKLPTHLTSLVKLSIENCPEMMVPLPTDLPSLEELN 2293

Query: 474  VDECKEL--------------------------------------------VDICGCDKL 489
            +  C E+                                            ++I  CDKL
Sbjct: 2294 IYYCPEMTPQFDNHEFPLMPLRGASRSAIGITSHIYLEEEEEQGLPYNLQHLEIRKCDKL 2353

Query: 490  EALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQWGLHRLTS 549
            E LP  +    SL +L I+ CP LVSFPE+GFP  L  L I N +    L +WGL RLTS
Sbjct: 2354 EKLPRGLQSYTSLAELIIEDCPKLVSFPEKGFPLMLRGLAISNCESLMPLSEWGLARLTS 2413

Query: 550  LKHLWIAVSDDEAECFPDEEIGM-TLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRI 608
            L+ L I     EA  F +       LPT+L  +    FQNL  L+ +  Q LTSL+ L +
Sbjct: 2414 LRTLTIGGIFLEATSFSNHHHHFFLLPTTLVEVCISSFQNLESLAFLSLQTLTSLRKLGV 2473

Query: 609  GNCPNLTSF-PEVGLPSSLLELHIYGCPNLKKACKRDQGKEWPKIAHIPFVGIDRKFIYD 667
              CP L SF P+ GLP  L EL+I  CP L + C +++G++WPKIAHIP V ID K I +
Sbjct: 2474 FQCPKLQSFIPKEGLPDMLSELYIRDCPLLIQRCSKEKGEDWPKIAHIPCVKIDGKLILE 2533

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090374|emb|CBI40193.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487172|ref|XP_002264364.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766792|emb|CAN69685.1| hypothetical protein VITISV_039904 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487176|ref|XP_003633526.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465831|ref|XP_002264750.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.634 0.299 0.389 1e-69
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.740 0.471 0.353 2.5e-69
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.481 0.179 0.262 2.5e-26
TAIR|locus:2151476 1168 VICTR "VARIATION IN COMPOUND T 0.217 0.125 0.339 3.2e-11
TAIR|locus:2151466 1353 VICTL "VARIATION IN COMPOUND T 0.217 0.107 0.339 4.6e-11
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.557 0.240 0.273 1.4e-10
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.552 0.268 0.266 6.4e-10
TAIR|locus:2151506 1127 RPS6 "RESISTANT TO P. SYRINGAE 0.213 0.126 0.327 1.1e-09
WB|WBGene00004929559 soc-2 [Caenorhabditis elegans 0.228 0.273 0.314 1.2e-05
UNIPROTKB|Q22875559 soc-2 "Leucine-rich repeat pro 0.228 0.273 0.314 1.2e-05
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 681 (244.8 bits), Expect = 1.0e-69, Sum P(2) = 1.0e-69
 Identities = 173/444 (38%), Positives = 246/444 (55%)

Query:     1 MAGGIIRQSRSKERLEDWGSKCFHDLVSRSIFQQTAISDSCKFVMHDLIHDLAELVSGET 60
             MA  ++ Q RS  RLED G+    DLV++S FQ+  I+ +  FVMHDL++DLA+ VSG+ 
Sbjct:   444 MAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMT-SFVMHDLMNDLAKAVSGDF 502

Query:    61 IFRLEEANTLSRRFERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSY 120
              FRLE+ N +       RH S++    D    F        LRT LP          +  
Sbjct:   503 CFRLEDDN-IPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPT--SLESLQ 559

Query:   121 ITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLL 180
             +T  VL+ LL     LR+LSL  Y+I  LP   + L+LLR+L+L+ T I+ LPE  C L 
Sbjct:   560 LTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLC 619

Query:   181 NLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLSNFIVGK 240
             NL+ L+L NC  L  LP+ +  LINLR LD+ G  L+ EMP G+K+L  LQ LSNF++G+
Sbjct:   620 NLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLV-EMPPGIKKLRSLQKLSNFVIGR 678

Query:   241 GECASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDS-- 298
                A GL +LK L+ L   L I+ L+NV     A++A L+ K  L+ L L+W  +     
Sbjct:   679 LSGA-GLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFV 737

Query:   299 PRD----AVLEEKVLDTLQPHERIKELAIKHYGGARFPPWIGQHSFSEMKVLKLENCDNC 354
             P      A  +++VL  L+PH  +K   I+ Y G  FP W+G  SF  +  + L +C+ C
Sbjct:   738 PGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLC 797

Query:   355 AALPSLGLMSSLKILAVKGLKKLKSIESEVY-GEGFS--MPFPSLEILSFESLPEWQHWN 411
              +LP +G + SLK L+++    L+ +  + + GE  S  +PF SL+IL F  +P W  W 
Sbjct:   798 ISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEW- 856

Query:   412 TNIKGNEPVEIFPRLQELSIAECP 435
               I       IFP LQ+L I  CP
Sbjct:   857 --ICPELEDGIFPCLQKLIIQRCP 878
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00004929 soc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q22875 soc-2 "Leucine-rich repeat protein soc-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028607001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (920 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 58.0 bits (140), Expect = 1e-08
 Identities = 57/193 (29%), Positives = 78/193 (40%), Gaps = 46/193 (23%)

Query: 479 ELVDICGCDKLEALPNDMHKLNSLRDL-------------GIQL----------CPNLVS 515
           E + +  C  L  LP+ +  LN L DL             GI L          C  L S
Sbjct: 660 ETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKS 719

Query: 516 FPEEGFPTNLTTLVIG---------NFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFP 566
           FP+    TN++ L +          N +L + L +  L  + S K LW  V        P
Sbjct: 720 FPD--ISTNISWLDLDETAIEEFPSNLRL-ENLDELILCEMKSEK-LWERVQ-------P 768

Query: 567 DEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPE-VGLPSS 625
              +   L  SLT L      +L+ L S   QNL  L++L I NC NL + P  + L  S
Sbjct: 769 LTPLMTMLSPSLTRLFLSDIPSLVELPS-SIQNLHKLEHLEIENCINLETLPTGINLE-S 826

Query: 626 LLELHIYGCPNLK 638
           L  L + GC  L+
Sbjct: 827 LESLDLSGCSRLR 839

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 671
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.7
KOG4237498 consensus Extracellular matrix protein slit, conta 99.66
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.29
KOG4341483 consensus F-box protein containing LRR [General fu 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
KOG4341483 consensus F-box protein containing LRR [General fu 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
PLN03150623 hypothetical protein; Provisional 98.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
PRK15386 426 type III secretion protein GogB; Provisional 98.6
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
PRK15386 426 type III secretion protein GogB; Provisional 98.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
PLN03150623 hypothetical protein; Provisional 98.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.46
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.25
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.1
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.93
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.41
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.32
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.72
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.61
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.58
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.21
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.46
smart0037026 LRR Leucine-rich repeats, outliers. 92.46
smart0037026 LRR Leucine-rich repeats, outliers. 89.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.86
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.82
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.26
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.3e-42  Score=398.00  Aligned_cols=503  Identities=17%  Similarity=0.211  Sum_probs=381.1

Q ss_pred             CCceeEEEeEeCCCCCccchhhhcccCCccEEecccccccCCCCCcccchhhhhhhhcCCCceeEEEecCCCcc-ccCcc
Q 005896           74 FERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDLLPMFKMLRMLSLQGYRIG-ELPIP  152 (671)
Q Consensus        74 ~~~~~~lsl~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~l~-~lp~~  152 (671)
                      ...++.+++..+.+.. ..+..+..+++|++|.+.+         |.+...++...|..+++||+|+|++|.+. .+|. 
T Consensus        68 ~~~v~~L~L~~~~i~~-~~~~~~~~l~~L~~L~Ls~---------n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~-  136 (968)
T PLN00113         68 SSRVVSIDLSGKNISG-KISSAIFRLPYIQTINLSN---------NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR-  136 (968)
T ss_pred             CCcEEEEEecCCCccc-cCChHHhCCCCCCEEECCC---------CccCCcCChHHhccCCCCCEEECcCCccccccCc-
Confidence            3578899998876655 3357788999999999999         55556788888889999999999999984 5554 


Q ss_pred             cCCCCccceeecCCCccc-ccchhhhccccCcEEecCCCccccccchhhhccCcceEEeecCCccccccCccCCCCCCCC
Q 005896          153 FEDLRLLRFLNLADTDIR-SLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQ  231 (671)
Q Consensus       153 ~~~l~~L~~L~L~~n~i~-~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~  231 (671)
                       +.+++|++|+|++|.++ .+|..++.+++|++|++++|.....+|..++++++|++|++++|.+.+.+|..++++++|+
T Consensus       137 -~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  215 (968)
T PLN00113        137 -GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLK  215 (968)
T ss_pred             -cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCcc
Confidence             46899999999999998 6799999999999999999955668999999999999999999998888999999999999


Q ss_pred             ccceeEecCCc-ccccccCchhhHhcCCccEEecccCCCChhhhhhhccCCCCCCCceEEEEecCCCCCCchhhHHHHhc
Q 005896          232 TLSNFIVGKGE-CASGLEDLKSLNLLCDELCIAGLENVNSPQNAREAALREKHNLEALTLEWGSQSDSPRDAVLEEKVLD  310 (671)
Q Consensus       232 ~L~~~~~~~~~-~~~~~~~l~~L~~L~~~l~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~  310 (671)
                      +|++..+.... .+..++.+.+|+.|.  +      ..+......+..++++++|+.|++++|.+.+..+         .
T Consensus       216 ~L~L~~n~l~~~~p~~l~~l~~L~~L~--L------~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p---------~  278 (968)
T PLN00113        216 WIYLGYNNLSGEIPYEIGGLTSLNHLD--L------VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP---------P  278 (968)
T ss_pred             EEECcCCccCCcCChhHhcCCCCCEEE--C------cCceeccccChhHhCCCCCCEEECcCCeeeccCc---------h
Confidence            99988776543 333355666666553  1      1222334456678889999999999888744332         2


Q ss_pred             cCCCCCCCcEEEEeccCCc-cCCCCCCCCCCCCccEEEEeCCCCCCCCC-CCCCCCCccEEEEeCCCCceeccccccCCC
Q 005896          311 TLQPHERIKELAIKHYGGA-RFPPWIGQHSFSEMKVLKLENCDNCAALP-SLGLMSSLKILAVKGLKKLKSIESEVYGEG  388 (671)
Q Consensus       311 ~l~~~~~L~~L~l~~~~~~-~~p~~~~~~~l~~L~~L~l~~~~~~~~~~-~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~  388 (671)
                      .+..+++|+.|++++|... .+|.++.  .+++|+.|++++|.+.+..| .++.+++|+.|++++|.....++..+..  
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~--~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~--  354 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLSGEIPELVI--QLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK--  354 (968)
T ss_pred             hHhhccCcCEEECcCCeeccCCChhHc--CCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhC--
Confidence            3445678999999988754 5677776  58899999999999887777 6889999999999998776666655544  


Q ss_pred             ccCCCCCcceeeccCcccccccccccCCCCccCCCCccceeeEecCCCCccCCC---CCCCCccEEEEeccCC---cCcc
Q 005896          389 FSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELP---GLLPSLETLVVRKCGK---LVVP  462 (671)
Q Consensus       389 ~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~lp---~~l~~L~~L~l~~~~~---l~~~  462 (671)
                          +++|+.|+++++.........+..      +++|+.|++++ +.+.+.+|   ..+++|+.|++++|..   ++..
T Consensus       355 ----~~~L~~L~Ls~n~l~~~~p~~~~~------~~~L~~L~l~~-n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~  423 (968)
T PLN00113        355 ----HNNLTVLDLSTNNLTGEIPEGLCS------SGNLFKLILFS-NSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSE  423 (968)
T ss_pred             ----CCCCcEEECCCCeeEeeCChhHhC------cCCCCEEECcC-CEecccCCHHHhCCCCCCEEECcCCEeeeECChh
Confidence                889999999887543333332222      67888898888 46666777   3578888998888854   3445


Q ss_pred             CCCCCCcceEEeccCCCcccccCCCCCccCcccCCCCCCCCeeEeecCCCCcccCCCCCCCCcceEEEccCcCccccccc
Q 005896          463 LSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSFPEEGFPTNLTTLVIGNFKLYKTLVQW  542 (671)
Q Consensus       463 ~~~~~~L~~L~l~~~~~~~~i~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~L~~L~l~~~~~l~~~~~~  542 (671)
                      +..+++|+.|++++|...         +.+|..+..+++|+.|++++|.....+|.....++|+.|++++|+..+..+. 
T Consensus       424 ~~~l~~L~~L~Ls~N~l~---------~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~-  493 (968)
T PLN00113        424 FTKLPLVYFLDISNNNLQ---------GRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPR-  493 (968)
T ss_pred             HhcCCCCCEEECcCCccc---------CccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccCh-
Confidence            667888899999888743         3456566778888888888887666666655567888888877765555544 


Q ss_pred             ccCCCCCcCeEEecccCCCcccCCcccccccCCCCcCeEeccCCCCCccCCccCCCCCCccCeEeecCCCCCCcCCC-CC
Q 005896          543 GLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLIFLSSMGFQNLTSLQYLRIGNCPNLTSFPE-VG  621 (671)
Q Consensus       543 ~~~~l~~L~~L~l~~~c~~~~~i~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~l~~l~~L~~L~l~~c~~l~~~~~-~~  621 (671)
                      .+.++++|+.|++++ |.....+|. .+  ..+++|++|++++|.-...+| ..+..+++|++|++++|+....+|. ..
T Consensus       494 ~~~~l~~L~~L~Ls~-N~l~~~~p~-~~--~~l~~L~~L~Ls~N~l~~~~p-~~~~~l~~L~~L~Ls~N~l~~~~p~~l~  568 (968)
T PLN00113        494 KLGSLSELMQLKLSE-NKLSGEIPD-EL--SSCKKLVSLDLSHNQLSGQIP-ASFSEMPVLSQLDLSQNQLSGEIPKNLG  568 (968)
T ss_pred             hhhhhhccCEEECcC-CcceeeCCh-HH--cCccCCCEEECCCCcccccCC-hhHhCcccCCEEECCCCcccccCChhHh
Confidence            477888888888888 555556665 44  467888888888844333455 7778888888888888865556665 23


Q ss_pred             CCCCccEEEEeCCh
Q 005896          622 LPSSLLELHIYGCP  635 (671)
Q Consensus       622 ~~~~L~~L~l~~c~  635 (671)
                      .+++|+.|++++|+
T Consensus       569 ~l~~L~~l~ls~N~  582 (968)
T PLN00113        569 NVESLVQVNISHNH  582 (968)
T ss_pred             cCcccCEEeccCCc
Confidence            46788888888886

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 79.6 bits (197), Expect = 2e-16
 Identities = 27/114 (23%), Positives = 48/114 (42%)

Query: 121 ITRSVLSDLLPMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLL 180
           +  +  S        L+ L L+   I  LP    +L+ L+ L + ++ + +L  +   L 
Sbjct: 170 LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLP 229

Query: 181 NLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQTLS 234
            LE L LR C+ L   P        L+ L ++    L  +P  +  L +L+ L 
Sbjct: 230 KLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLD 283
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.47
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.19
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.15
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.91
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.45
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.11
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.1
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.09
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.97
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 87.57
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 81.53
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1e-43  Score=401.35  Aligned_cols=526  Identities=16%  Similarity=0.099  Sum_probs=293.6

Q ss_pred             CceeEEEeEeCCCCCccchhhhcccCCccEEecccccccCCCCCcccchhhhhhh--hcCCCceeEEEecCCCccccCcc
Q 005896           75 ERVRHSSYACGGRDGKNMFEVFNEIGHLRTFLPLRLRIRGGSNTSYITRSVLSDL--LPMFKMLRMLSLQGYRIGELPIP  152 (671)
Q Consensus        75 ~~~~~lsl~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~--~~~l~~L~~L~L~~~~l~~lp~~  152 (671)
                      ...+++.+..+..........+.++++|++|.+.+         |.+....+..+  +.++++|++|++++|.+.... .
T Consensus       126 ~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~---------n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~-~  195 (768)
T 3rgz_A          126 SGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA---------NSISGANVVGWVLSDGCGELKHLAISGNKISGDV-D  195 (768)
T ss_dssp             TTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCS---------SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCC-B
T ss_pred             CCCCEEECcCCccCCcCCHHHhccCCCCCEEECCC---------CccCCcCChhhhhhccCCCCCEEECCCCcccccC-C
Confidence            46777887766544322222235677777777777         33333222221  555666666666666554322 1


Q ss_pred             cCCCCccceeecCCCcccccchhhhccccCcEEecCCCccccccchhhhccCcceEEeecCCccccccCccCCCCCCCCc
Q 005896          153 FEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLDIRGAKLLKEMPFGMKELNKLQT  232 (671)
Q Consensus       153 ~~~l~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~  232 (671)
                      +..+++|++|+|++|.++..++.++++++|++|++++|...+.+|..++.+++|++|++++|.+.+.+|..  .+++|++
T Consensus       196 ~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~  273 (768)
T 3rgz_A          196 VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQY  273 (768)
T ss_dssp             CTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCE
T ss_pred             cccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCE
Confidence            24555566666666655543222555566666666655322345555555555555555555544444332  4455555


Q ss_pred             cceeEecCC-cccccccC-chhhHhcCCccEEecccCCCChhhhhhhc-------------------------cCCCCCC
Q 005896          233 LSNFIVGKG-ECASGLED-LKSLNLLCDELCIAGLENVNSPQNAREAA-------------------------LREKHNL  285 (671)
Q Consensus       233 L~~~~~~~~-~~~~~~~~-l~~L~~L~~~l~~~~~~~~~~~~~~~~~~-------------------------l~~l~~L  285 (671)
                      |++..+... ..+..+.. +.+|+.|..        ..+......+..                         +.++++|
T Consensus       274 L~L~~n~l~~~ip~~~~~~~~~L~~L~L--------s~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L  345 (768)
T 3rgz_A          274 LSLAENKFTGEIPDFLSGACDTLTGLDL--------SGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL  345 (768)
T ss_dssp             EECCSSEEEESCCCCSCTTCTTCSEEEC--------CSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTC
T ss_pred             EECcCCccCCccCHHHHhhcCcCCEEEC--------cCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCC
Confidence            544443322 11111211 133332210        011111122233                         4445555


Q ss_pred             CceEEEEecCCCCCCchhhHHHHhccCCCCC-CCcEEEEeccCCc-cCCCCCCCCCCCCccEEEEeCCCCCCCCC-CCCC
Q 005896          286 EALTLEWGSQSDSPRDAVLEEKVLDTLQPHE-RIKELAIKHYGGA-RFPPWIGQHSFSEMKVLKLENCDNCAALP-SLGL  362 (671)
Q Consensus       286 ~~L~l~~~~~~~~~~~~~~~~~~~~~l~~~~-~L~~L~l~~~~~~-~~p~~~~~~~l~~L~~L~l~~~~~~~~~~-~l~~  362 (671)
                      +.|++++|.+.+..+...         ..++ +|+.|+++++... .+|.++....+++|++|++++|.+.+.+| .++.
T Consensus       346 ~~L~Ls~n~l~~~~p~~l---------~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~  416 (768)
T 3rgz_A          346 KVLDLSFNEFSGELPESL---------TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN  416 (768)
T ss_dssp             CEEECCSSEEEECCCTTH---------HHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG
T ss_pred             CEEeCcCCccCccccHHH---------HhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc
Confidence            555555554422222111         1112 5555555555432 23444432225566666666666655555 5666


Q ss_pred             CCCccEEEEeCCCCceeccccccCCCccCCCCCcceeeccCcccccccccccCCCCccCCCCccceeeEecCCCCccCCC
Q 005896          363 MSSLKILAVKGLKKLKSIESEVYGEGFSMPFPSLEILSFESLPEWQHWNTNIKGNEPVEIFPRLQELSIAECPQLSGELP  442 (671)
Q Consensus       363 l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~lp  442 (671)
                      +++|++|++++|.....++..+..      +++|+.|+++++.........+..      +++|++|++++ +++++.+|
T Consensus       417 l~~L~~L~Ls~N~l~~~~p~~l~~------l~~L~~L~L~~n~l~~~~p~~~~~------l~~L~~L~L~~-N~l~~~~p  483 (768)
T 3rgz_A          417 CSELVSLHLSFNYLSGTIPSSLGS------LSKLRDLKLWLNMLEGEIPQELMY------VKTLETLILDF-NDLTGEIP  483 (768)
T ss_dssp             CTTCCEEECCSSEEESCCCGGGGG------CTTCCEEECCSSCCCSCCCGGGGG------CTTCCEEECCS-SCCCSCCC
T ss_pred             CCCCCEEECcCCcccCcccHHHhc------CCCCCEEECCCCcccCcCCHHHcC------CCCceEEEecC-CcccCcCC
Confidence            666666666666544444444433      666677766665533233222222      67777777777 46665666


Q ss_pred             C---CCCCccEEEEeccCCc---CccCCCCCCcceEEeccCCCcccccCCCCCccCcccCCCCCCCCeeEeecCCCCccc
Q 005896          443 G---LLPSLETLVVRKCGKL---VVPLSSYPMLCRLEVDECKELVDICGCDKLEALPNDMHKLNSLRDLGIQLCPNLVSF  516 (671)
Q Consensus       443 ~---~l~~L~~L~l~~~~~l---~~~~~~~~~L~~L~l~~~~~~~~i~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~  516 (671)
                      .   .+++|+.|++++|...   +..+..+++|++|++++|...         +.+|..+..+++|+.|++++|+....+
T Consensus       484 ~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~---------~~~p~~l~~l~~L~~L~Ls~N~l~g~i  554 (768)
T 3rgz_A          484 SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS---------GNIPAELGDCRSLIWLDLNTNLFNGTI  554 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE---------EECCGGGGGCTTCCEEECCSSEEESBC
T ss_pred             HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCccc---------CcCCHHHcCCCCCCEEECCCCccCCcC
Confidence            3   4677777777777533   344556777777777777643         467777888888888888888544344


Q ss_pred             CCC-----------------------------------------------------------------------CCCCCc
Q 005896          517 PEE-----------------------------------------------------------------------GFPTNL  525 (671)
Q Consensus       517 ~~~-----------------------------------------------------------------------~~~~~L  525 (671)
                      |..                                                                       ..+++|
T Consensus       555 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L  634 (768)
T 3rgz_A          555 PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM  634 (768)
T ss_dssp             CGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCC
T ss_pred             ChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccc
Confidence            321                                                                       123678


Q ss_pred             ceEEEccCcCcccccccccCCCCCcCeEEecccCCCcccCCcccccccCCCCcCeEeccCCCCCc-cCCccCCCCCCccC
Q 005896          526 TTLVIGNFKLYKTLVQWGLHRLTSLKHLWIAVSDDEAECFPDEEIGMTLPTSLTHLSFCGFQNLI-FLSSMGFQNLTSLQ  604 (671)
Q Consensus       526 ~~L~l~~~~~l~~~~~~~~~~l~~L~~L~l~~~c~~~~~i~~~~~~~~~~~~L~~L~l~~c~~l~-~l~~~~l~~l~~L~  604 (671)
                      +.|++++|+..+.+|. .++++++|+.|++++ |...+.+|. .+  ..+++|++|++++ |+++ .+| ..+..+++|+
T Consensus       635 ~~LdLs~N~l~g~ip~-~l~~l~~L~~L~Ls~-N~l~g~ip~-~l--~~L~~L~~LdLs~-N~l~g~ip-~~l~~l~~L~  707 (768)
T 3rgz_A          635 MFLDMSYNMLSGYIPK-EIGSMPYLFILNLGH-NDISGSIPD-EV--GDLRGLNILDLSS-NKLDGRIP-QAMSALTMLT  707 (768)
T ss_dssp             CEEECCSSCCBSCCCG-GGGGCTTCCEEECCS-SCCCSCCCG-GG--GGCTTCCEEECCS-SCCEECCC-GGGGGCCCCS
T ss_pred             cEEECcCCcccccCCH-HHhccccCCEEeCcC-CccCCCCCh-HH--hCCCCCCEEECCC-CcccCcCC-hHHhCCCCCC
Confidence            8899988776656665 588899999999998 554557777 55  5788999999999 4565 667 7888999999


Q ss_pred             eEeecCCCCCCcCCCCCCCCCccEEEEeCChhh-----HHHHhhCCCCCCCceeccceEE
Q 005896          605 YLRIGNCPNLTSFPEVGLPSSLLELHIYGCPNL-----KKACKRDQGKEWPKIAHIPFVG  659 (671)
Q Consensus       605 ~L~l~~c~~l~~~~~~~~~~~L~~L~l~~c~~l-----~~~~~~~~~~~~~~~~~~~~~~  659 (671)
                      +|++++|+....+|..+.+.++....+.+||.|     . .|....+++|++++|+++.+
T Consensus       708 ~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          708 EIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             EEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC--------------
T ss_pred             EEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCccCCCCCCCCccccC
Confidence            999999966677887666666666666676543     3 68888999999999999865
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 671
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 42.5 bits (98), Expect = 1e-04
 Identities = 16/77 (20%), Positives = 30/77 (38%), Gaps = 7/77 (9%)

Query: 131 PMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNC 190
            +   L  L++   ++ ELP        L  L  +   +  +PE      NL+ L +   
Sbjct: 281 DLPPSLEELNVSNNKLIELP---ALPPRLERLIASFNHLAEVPEL---PQNLKQLHVEYN 334

Query: 191 SRLIKLPQEMRNLINLR 207
             L + P    ++ +LR
Sbjct: 335 -PLREFPDIPESVEDLR 350
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.27
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.77
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.75
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.52
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.90  E-value=2.8e-22  Score=205.53  Aligned_cols=85  Identities=16%  Similarity=0.269  Sum_probs=69.4

Q ss_pred             cCCCceeEEEecCCCccccCcccCCCCccceeecCCCcccccchhhhccccCcEEecCCCccccccchhhhccCcceEEe
Q 005896          131 PMFKMLRMLSLQGYRIGELPIPFEDLRLLRFLNLADTDIRSLPESKCKLLNLEILILRNCSRLIKLPQEMRNLINLRHLD  210 (671)
Q Consensus       131 ~~l~~L~~L~L~~~~l~~lp~~~~~l~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~  210 (671)
                      ..+.+|++|++++++|+.+ +.+..+++|++|+|++|+|+.+|. ++++++|++|++++| .+..+++ ++.+++|+.|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~~-l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADITP-LANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCGG-GTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-ccccccc-ccccccccccc
Confidence            3456788999999888887 467888999999999999988864 888999999999998 7777775 88889999999


Q ss_pred             ecCCcccccc
Q 005896          211 IRGAKLLKEM  220 (671)
Q Consensus       211 L~~~~~~~~~  220 (671)
                      ++++. ...+
T Consensus       117 ~~~~~-~~~~  125 (384)
T d2omza2         117 LFNNQ-ITDI  125 (384)
T ss_dssp             CCSSC-CCCC
T ss_pred             ccccc-cccc
Confidence            88887 4333
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure