Citrus Sinensis ID: 006039
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 663 | ||||||
| 224068671 | 819 | predicted protein [Populus trichocarpa] | 0.957 | 0.775 | 0.597 | 0.0 | |
| 224128195 | 812 | predicted protein [Populus trichocarpa] | 0.948 | 0.774 | 0.582 | 0.0 | |
| 359479972 | 842 | PREDICTED: uncharacterized protein LOC10 | 0.954 | 0.751 | 0.612 | 0.0 | |
| 356503960 | 832 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.759 | 0.578 | 0.0 | |
| 356571017 | 804 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.761 | 0.572 | 0.0 | |
| 297744044 | 780 | unnamed protein product [Vitis vinifera] | 0.862 | 0.733 | 0.584 | 0.0 | |
| 357511481 | 860 | LIM domain and RING finger protein [Medi | 0.947 | 0.730 | 0.548 | 0.0 | |
| 449436365 | 824 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.770 | 0.580 | 0.0 | |
| 297821122 | 811 | zinc finger family protein [Arabidopsis | 0.903 | 0.738 | 0.504 | 1e-160 | |
| 15228713 | 812 | RING/U-box domain-containing protein [Ar | 0.904 | 0.738 | 0.502 | 1e-158 |
| >gi|224068671|ref|XP_002302796.1| predicted protein [Populus trichocarpa] gi|222844522|gb|EEE82069.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 757 bits (1954), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 399/668 (59%), Positives = 491/668 (73%), Gaps = 33/668 (4%)
Query: 5 TKGDSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEY 64
+ GDS VDG+ESERGGFMGHPMCEFC+ PFYGDNELY HMSTEHYTCH+CQRQHPGQYEY
Sbjct: 174 STGDSDVDGSESERGGFMGHPMCEFCKKPFYGDNELYKHMSTEHYTCHLCQRQHPGQYEY 233
Query: 65 YKNYDDLEIHFRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHGGRMSRAKRNAALQI 124
YKNYDDLEIHFRRDHFLC+DE CLAKKF+VFQ+EAE+KRHN IEH G MSR++RNAALQI
Sbjct: 234 YKNYDDLEIHFRRDHFLCDDEGCLAKKFIVFQTEAELKRHNTIEHAGHMSRSQRNAALQI 293
Query: 125 PICFRYRRNNEQEHRRGRGRTFHRESSDVNELSMAIQASLETVGADSTSYDPSSSRSLVS 184
P FRYRR+NEQ++R GRGRTF R+ SD N+LS+AIQASLE ++STS D SSS +S
Sbjct: 294 PTSFRYRRSNEQDNRHGRGRTFRRDQSD-NQLSIAIQASLEAAYSESTSRDRSSSAQAIS 352
Query: 185 DHGDAEDIDTLIQPFESLATTDSELASRYLQALGQNSRTAPLEESSFPPLPMASSSSQQN 244
DH D DID ++QPFESL+ TD E RYLQALG +SR APL+ESSFPPL +SS QQ
Sbjct: 353 DHVDLSDIDPIVQPFESLSATDPETTLRYLQALGPSSRNAPLQESSFPPLFTTTSSGQQK 412
Query: 245 PRSNSEGLP-NSMAAHLRRKNNRNVTVLHAGLGWPSASQRPVLSSNNSTQPRRAANIGSA 303
+ SE LP N+MA HLRR+NNRN TV+++ WP+AS+ V SS +P +
Sbjct: 413 AKDESESLPNNTMATHLRRQNNRNATVVNSPQQWPAASRGHVSSSPALYRP--TVDTSPL 470
Query: 304 VSQSSSGSRTVSCKAASAQAQVLAQSTAV----SSASSRNSGNIRRITHSASAPNLAN-G 358
S+SS+ +S A+S Q+ + AV S+ S SG RI+ +ASA NLA+ G
Sbjct: 471 SSRSSASGPGLSSYASSIQSHAQTRPAAVRGHPSAGSVGISGTTSRISSTASASNLADSG 530
Query: 359 SVEPSVSDFPPVSAMRTDKMPSISQPAPSVENIQAANRSLVERMRAAFEYDEDKYTAFKD 418
S++PSVSDFPPVSA+ KMP+ SQ +VE Q AN+SLVE++RAA E DED+YT FKD
Sbjct: 531 SLKPSVSDFPPVSAVPMHKMPTSSQVVLNVEEFQTANKSLVEKIRAALENDEDRYTLFKD 590
Query: 419 ITAQYRQGLIDTRKYLEYVKQYGLSHLVLELARLCPDALKQKELIETYNATLQGNNQLDN 478
I+ QYRQG IDT +YL+YV+Q+GLS L+ ELARLCPDA KQKEL+ETYNA+L+ + + +N
Sbjct: 591 ISGQYRQGSIDTGEYLDYVQQFGLSRLIPELARLCPDAQKQKELVETYNASLRSSGKKEN 650
Query: 479 DWAHISVRAKDTNGSKKSKGKSVATEACKNDKGKSTVANDSNSKHAVANNFLSTVRELQS 538
W S + K TNGSK +GK NDS+SK + ++F++TVR LQS
Sbjct: 651 GWGRGSAQLKGTNGSK---------------EGKGIAENDSSSKDRLTDSFINTVRALQS 695
Query: 539 SFKPSEEDEEVLSKDGYRGAKGKSKPMVDE---QLRGQNDLTSAGGGSSQTSVDRGGGGK 595
++KP E++ ++LSKDGYR AKGKS M+DE + R QN SAG GSS+ D GG K
Sbjct: 696 NYKPVEDEAQLLSKDGYRAAKGKSNVMLDERQMEPRIQNGSLSAGDGSSKNLKD-GGTEK 754
Query: 596 QRKKTSKFHRVRLGDGSMAALLDLKNSDTGPDP-EPLDSRLDGNQNPAEGLPVPVRGVWK 654
QRKKTSK HR RLGDGSMAALLDL+NS+ PDP E +++R+D + N GL PVRGVW+
Sbjct: 755 QRKKTSKVHRARLGDGSMAALLDLQNSE--PDPRETVENRIDDSSNSVGGL--PVRGVWR 810
Query: 655 RGGGHKLF 662
+GGG KLF
Sbjct: 811 KGGGQKLF 818
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224128195|ref|XP_002320267.1| predicted protein [Populus trichocarpa] gi|222861040|gb|EEE98582.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359479972|ref|XP_003632382.1| PREDICTED: uncharacterized protein LOC100262296 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356503960|ref|XP_003520767.1| PREDICTED: uncharacterized protein LOC100799878 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356571017|ref|XP_003553678.1| PREDICTED: uncharacterized protein LOC100780426 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297744044|emb|CBI37014.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357511481|ref|XP_003626029.1| LIM domain and RING finger protein [Medicago truncatula] gi|355501044|gb|AES82247.1| LIM domain and RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449436365|ref|XP_004135963.1| PREDICTED: uncharacterized protein LOC101214376 [Cucumis sativus] gi|449488786|ref|XP_004158171.1| PREDICTED: uncharacterized protein LOC101227037 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297821122|ref|XP_002878444.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297324282|gb|EFH54703.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15228713|ref|NP_191783.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|6899934|emb|CAB71884.1| putative zinc-finger protein [Arabidopsis thaliana] gi|28058808|gb|AAO29956.1| putative zinc-finger protein [Arabidopsis thaliana] gi|34098831|gb|AAQ56798.1| At3g62240 [Arabidopsis thaliana] gi|332646805|gb|AEE80326.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 663 | ||||||
| TAIR|locus:2097988 | 812 | AT3G62240 [Arabidopsis thalian | 0.420 | 0.343 | 0.570 | 9.2e-137 | |
| TAIR|locus:2041464 | 766 | AT2G47090 "AT2G47090" [Arabido | 0.749 | 0.648 | 0.401 | 8.3e-90 | |
| POMBASE|SPCC1223.01 | 732 | SPCC1223.01 "ubiquitin-protein | 0.236 | 0.214 | 0.398 | 5.8e-28 | |
| ASPGD|ASPL0000055640 | 767 | AN10068 [Emericella nidulans ( | 0.190 | 0.164 | 0.469 | 2.3e-27 | |
| UNIPROTKB|F1NQS9 | 875 | ZNF598 "Uncharacterized protei | 0.167 | 0.126 | 0.353 | 7e-24 | |
| ZFIN|ZDB-GENE-060602-3 | 953 | znf598 "zinc finger protein 59 | 0.173 | 0.120 | 0.358 | 2.2e-22 | |
| UNIPROTKB|H3BQQ2 | 849 | ZNF598 "Zinc finger protein 59 | 0.167 | 0.130 | 0.344 | 2.7e-22 | |
| UNIPROTKB|Q86UK7 | 904 | ZNF598 "Zinc finger protein 59 | 0.167 | 0.122 | 0.344 | 3.3e-22 | |
| SGD|S000002674 | 639 | HEL2 "RING finger ubiquitin li | 0.146 | 0.151 | 0.459 | 6.4e-22 | |
| UNIPROTKB|F1Q034 | 909 | ZNF598 "Uncharacterized protei | 0.170 | 0.124 | 0.327 | 2.4e-21 |
| TAIR|locus:2097988 AT3G62240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 833 (298.3 bits), Expect = 9.2e-137, Sum P(3) = 9.2e-137
Identities = 169/296 (57%), Positives = 204/296 (68%)
Query: 7 GDSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYK 66
GDS VDG+ESERGGF GHPMCEFCR PFYGDNELYTHMSTEHYTCH+CQR PGQYEYYK
Sbjct: 180 GDSEVDGSESERGGFAGHPMCEFCRNPFYGDNELYTHMSTEHYTCHLCQRSQPGQYEYYK 239
Query: 67 NYDDLEIHFRRDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHGGRMSRAKRNAALQIPI 126
NYDDLEIHFRRDHFLCED++CLAKKF VFQ+E+E+KRHNAIEHGG+MSR++R+AALQIP
Sbjct: 240 NYDDLEIHFRRDHFLCEDDSCLAKKFTVFQNESELKRHNAIEHGGKMSRSQRSAALQIPT 299
Query: 127 CFRYRRNNEQEHRRGRGRTFHRESSDVNELSMAIQASLETVGADXXXXXXXXXXXLV--- 183
FRY R N+QE+RRGR R+F RE D E ++A+ A+L ++
Sbjct: 300 SFRYSRGNDQENRRGRPRSFRREPGD-EEYNLAVHAALRLSESEYSRQEPAPPPSSAPPG 358
Query: 184 -SDHGD--AEDIDTLIQPFESLATTDSELASRYLQALGQ-NSRTAPLEESSFPPLPMAXX 239
S++ + +D D LIQP ESL+TTD E +SRYLQA+G + L ES+FPPL
Sbjct: 359 FSENNNIHVDDTDPLIQPMESLSTTDMEPSSRYLQAVGSFGGGGSRLGESAFPPL----- 413
Query: 240 XXXXXXXXXXEGLP-NSMAAHLRRKNNRNVT---VLHAGLGWPSASQRPVLSSNNS 291
E LP N+MAA LRR+ NR T + GWP ++ P +S S
Sbjct: 414 SGQQSSGQNVESLPTNTMAARLRRQTNRTSTASAIASPSQGWPVINRGPGQASITS 469
|
|
| TAIR|locus:2041464 AT2G47090 "AT2G47090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1223.01 SPCC1223.01 "ubiquitin-protein ligase E3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000055640 AN10068 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQS9 ZNF598 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060602-3 znf598 "zinc finger protein 598" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BQQ2 ZNF598 "Zinc finger protein 598" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86UK7 ZNF598 "Zinc finger protein 598" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002674 HEL2 "RING finger ubiquitin ligase (E3)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q034 ZNF598 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 663 | |||
| COG5236 | 493 | COG5236, COG5236, Uncharacterized conserved protei | 2e-27 |
| >gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Score = 116 bits (291), Expect = 2e-27
Identities = 46/118 (38%), Positives = 61/118 (51%), Gaps = 2/118 (1%)
Query: 17 ERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKNYDDLEIHFR 76
E GF GHP+C FC+ FY D+EL H H CHIC P +Y+Y+K+Y+DLE HFR
Sbjct: 213 EEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFR 272
Query: 77 RDHFLCEDEACLAKKFVVFQSEAEMKRHNAIEHG--GRMSRAKRNAALQIPICFRYRR 132
H+ C + C K VF E+ H H R+S R IP+ ++R
Sbjct: 273 NAHYCCTFQTCRVGKCYVFPYHTELLEHLTRFHKVNARLSEIPRPGRCSIPVMDPFKR 330
|
Length = 493 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 663 | |||
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 99.82 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 98.68 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 98.56 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 98.34 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 98.31 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.3 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.09 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 97.96 | |
| PHA00733 | 128 | hypothetical protein | 97.89 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 97.86 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 97.73 | |
| KOG2893 | 341 | consensus Zn finger protein [General function pred | 97.42 | |
| PHA00733 | 128 | hypothetical protein | 97.36 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 97.32 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.26 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 97.19 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 96.9 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 96.62 | |
| PHA00732 | 79 | hypothetical protein | 96.08 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 95.83 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 95.76 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.59 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 95.48 | |
| PHA00732 | 79 | hypothetical protein | 94.58 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 93.79 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 93.19 | |
| PHA00616 | 44 | hypothetical protein | 93.11 | |
| PHA00616 | 44 | hypothetical protein | 92.95 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 92.93 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.52 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 92.39 | |
| KOG2482 | 423 | consensus Predicted C2H2-type Zn-finger protein [T | 91.12 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 91.08 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 90.12 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 89.25 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 89.25 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 88.57 | |
| COG5602 | 1163 | SIN3 Histone deacetylase complex, SIN3 component [ | 88.57 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 87.28 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 86.3 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 85.31 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 84.77 | |
| PF02671 | 47 | PAH: Paired amphipathic helix repeat; InterPro: IP | 84.26 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 83.33 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 82.51 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 81.68 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 80.59 |
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-37 Score=348.59 Aligned_cols=480 Identities=27% Similarity=0.341 Sum_probs=301.1
Q ss_pred ccCCCCCCCCcccCCcccCCCcCCCCCCccCCchhHHhhhcCCCccCCCCCCCCCCCccccCCchhhhccccccceecCc
Q 006039 5 TKGDSVVDGTESERGGFMGHPMCEFCRTPFYGDNELYTHMSTEHYTCHICQRQHPGQYEYYKNYDDLEIHFRRDHFLCED 84 (663)
Q Consensus 5 ~~gd~~~~g~~~~~~GfkGHP~C~fC~KrF~d~deL~~HmReKHf~C~iC~k~~~~k~~YF~~~~~LekH~R~khf~Ce~ 84 (663)
..||.|+ .+++|||+|+||..+|++.++|++||+..||.|++|++. +++++||.+|.+|+.|++..||.|++
T Consensus 170 ~~gd~d~-------~s~rGhp~C~~C~~~fld~~el~rH~~~~h~~chfC~~~-~~~neyy~~~~dLe~HfR~~HflCE~ 241 (669)
T KOG2231|consen 170 MFGDPDD-------ESCRGHPLCKFCHERFLDDDELYRHLRFDHEFCHFCDYK-TGQNEYYNDYDDLEEHFRKGHFLCEE 241 (669)
T ss_pred hcCCCcc-------ccccCCccchhhhhhhccHHHHHHhhccceeheeecCcc-cccchhcccchHHHHHhhhcCccccc
Confidence 4577733 469999999999999999999999999999999999985 89999999999999999999999998
Q ss_pred cccCccccccc-ccchhhhcccccccCCCCChhhhhccccccccccccCchhhhhccCCCCCCCCCChhH--HHHHHHHH
Q 006039 85 EACLAKKFVVF-QSEAEMKRHNAIEHGGRMSRAKRNAALQIPICFRYRRNNEQEHRRGRGRTFHRESSDV--NELSMAIQ 161 (663)
Q Consensus 85 ~~C~kkKfVVF-~sesdLk~H~r~HHGek~sr~~r~~a~~i~~~f~yr~~~e~~~r~g~gr~~~r~~~d~--~~~s~ai~ 161 (663)
..|..++|+|| ..+.+|++|.+ ++.+.|.|.+.. .|+|+.....|++... ....+++.
T Consensus 242 ~~C~~~~f~~~~~~ei~lk~~~~----------------~~~~e~~~~~~~---~r~Gr~s~~~r~~~~~~~~~~~~~~~ 302 (669)
T KOG2231|consen 242 EFCRTKKFYVAFELEIELKAHNR----------------FIQHEKCYICRP---SRPGRPSSRYRGPYRRLESHFRVSDE 302 (669)
T ss_pred cccccceeeehhHHHHHHHhhcc----------------ccchheeccCCc---ccCCCCcccccCCccccccccccccc
Confidence 88999999986 89999999972 445556665432 1223222211211110 00011110
Q ss_pred H-hhhhcc--CCCCCCCCCCCCCCccCCCCcccccccccccccccCCCchhhhhHHHHhccCCC-CCCCCCCCCCCCCCC
Q 006039 162 A-SLETVG--ADSTSYDPSSSRSLVSDHGDAEDIDTLIQPFESLATTDSELASRYLQALGQNSR-TAPLEESSFPPLPMA 237 (663)
Q Consensus 162 a-s~era~--~~~sf~~iss~~~~l~~~~~~~el~~li~~~~~lf~~~s~~~~r~a~~~~~~~~-~~~~~~e~FP~Lpg~ 237 (663)
+ ..+.+. ....| -....+...++.+.+++.....+..+++......... ..+.+.+.+|..-+.
T Consensus 303 ~~~~~t~pq~~~~~~------------~~~~~~~s~~~~~~~~~~s~~~~~~~~~~~~~~s~~~~~sr~~~~a~~~~~~~ 370 (669)
T KOG2231|consen 303 ARDGSTAPQGKGNNF------------GSRRDEGSPLAGNRQELPSTANGNPSRFTSPNSSRINAASRQIRKADPAVVGQ 370 (669)
T ss_pred ccCccccCccccccC------------CccccccCcccccccccccccCCCCCcccCCccchhccccccccccccccccc
Confidence 0 011111 11111 0012233334455555555544444443322221111 123333333333221
Q ss_pred CCCCCCCCCCCCCCCc-chhhHhhhhccCCceeeeccCCCCCCCCCCCCcCCCCCCCccccccCCCC-----cccCCCCC
Q 006039 238 SSSSQQNPRSNSEGLP-NSMAAHLRRKNNRNVTVLHAGLGWPSASQRPVLSSNNSTQPRRAANIGSA-----VSQSSSGS 311 (663)
Q Consensus 238 ~~~~~~~s~~~~~~~~-nt~Aa~l~~~s~r~~~vl~ss~~~p~~~~~~~~~~s~~~~s~pa~~~~~~-----ss~~~~~~ 311 (663)
..+ .++..+.. +++..++....++...+-..+++|+..++.+...+.......|+.+.+.+ +..-.++.
T Consensus 371 ~~S-----~~~s~S~~~~~~~~~~~~~t~r~a~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~s~~~~s~~~~rv~~~~ 445 (669)
T KOG2231|consen 371 IIS-----LAGSSSSSSTPGRSRISPVTNRSAAAPGAAAPYPAPNRGPGENSIKSLRRVPSSGRSAASQSLSSDRVEQTR 445 (669)
T ss_pred ccc-----cCCCCcCcCccccccccccccccccCCccccCccccccCcccccccccccccccccchhhccccccccccCC
Confidence 111 11222222 56666666666666554466678888888776655433222221111111 11111111
Q ss_pred CccccchhhhHhHhhhhccccccCCCCCCCCccccccCCCCCCCCCCCCC--CCCCCCCCCc--cCcCCC---CCCCCCC
Q 006039 312 RTVSCKAASAQAQVLAQSTAVSSASSRNSGNIRRITHSASAPNLANGSVE--PSVSDFPPVS--AMRTDK---MPSISQP 384 (663)
Q Consensus 312 ~~~s~~s~s~qa~~~~~~g~~p~~~~~~~gss~~i~hs~s~p~~~~~~s~--ps~~dFP~ls--Aa~~~~---~p~~~q~ 384 (663)
|-++-.-..++ . .+ -.-+..+.|.+.++.+. ++..++|+++ ...+++ |++..-.
T Consensus 446 p~a~~~~~~~~--k---~~--------------e~~~~ps~~~~ss~r~~~~~~ss~~~~~s~~~~~n~~s~~~s~~~~~ 506 (669)
T KOG2231|consen 446 PLASVVLQIAR--K---AA--------------ETPSSPSSPYNSSTRSTAQPSSSLGPQSSLPSLKNRKSSSTSAPRGH 506 (669)
T ss_pred Ccchhhhhhhh--h---cc--------------ccCCCCcchhhhhcccccCCccccCccccchhhcCccccccCCCCCC
Confidence 11100011111 0 00 01122233333333333 4566677666 333222 1122223
Q ss_pred CCCHHHHHHHHHHHHHHHHHHhcCChHHHHHHHHHHHhhhcCcccHHHHHHHHHHhchhhhHHHHHHhCCChHHHHHHHH
Q 006039 385 APSVENIQAANRSLVERMRAAFEYDEDKYTAFKDITAQYRQGLIDTRKYLEYVKQYGLSHLVLELARLCPDALKQKELIE 464 (663)
Q Consensus 385 ~~~ve~~~aank~LVe~Ir~~L~~de~~~~~Fk~~s~~yr~G~i~a~~Y~~~v~~~Gl~~lvpELarLlPD~~Kq~eL~~ 464 (663)
...+-++..+|++|||+++..|+.+|+.|.+||..+..||.++|++..|..++...|+.+++++|+||||++..+.+|+.
T Consensus 507 ~~g~p~~~~~~~~~~e~~~~~~~~~e~~~~~~k~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~r~~ppp~~~s~i~~ 586 (669)
T KOG2231|consen 507 SQGPPDVSSANKALGEKNIKNLGHKESPSAAPKNFSGKYRKNSIDARTNGAPVTPYGLSPLLLDGARLCPPPGLVSNIIK 586 (669)
T ss_pred CCCCCCcccchhhhhHHhhhccccccchhhCcCCCCCcccccccchhhccCcCCCcCCCccccCCCCCCCCchhcccccc
Confidence 33446889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhcccCCCCCcccccccccccCCCccCCCcccccccccccCCCccccCCCCchhhhhhhHHHHHHHHhhcCCCCc
Q 006039 465 TYNATLQGNNQLDNDWAHISVRAKDTNGSKKSKGKSVATEACKNDKGKSTVANDSNSKHAVANNFLSTVRELQSSFKPSE 544 (663)
Q Consensus 465 a~~~~~r~~~~~~ng~~~~~~~~k~~~~~~k~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~lq~~~~~~e 544 (663)
.+++.+.. |-|+|.+.+ .+..++..++|+.+++.+|....+++
T Consensus 587 ~~~a~~~~----------------------k~~~~~~~~---------------~~~p~s~~~~~~~~~~~~~~~~~~q~ 629 (669)
T KOG2231|consen 587 SSNALLNS----------------------KNKPKPVKY---------------PDPPDSKPRNQILTVRRLQLLDPKQA 629 (669)
T ss_pred Cccccccc----------------------ccccccccc---------------CCCCCcccccccchhhhhhhccchhh
Confidence 88866622 556666655 56899999999999999999999888
Q ss_pred ccccccccccccCCCCCcccccccccccCCCcccCCCCCCccccCCCCCCcccccccchhhcc
Q 006039 545 EDEEVLSKDGYRGAKGKSKPMVDEQLRGQNDLTSAGGGSSQTSVDRGGGGKQRKKTSKFHRVR 607 (663)
Q Consensus 545 ~~~~vl~k~~~~~~~gk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~~k~~kk~skf~r~r 607 (663)
++ -+|.-|+..+|++...-- .+. +...++.+|++|||++|
T Consensus 630 ~~---k~~~~~~~~~~~~~~~~~-----------~~~---------~~k~q~~~~~~~~~~~~ 669 (669)
T KOG2231|consen 630 GK---KDKFQDGSDSGNLYFLNL-----------FSE---------LDKQQELKKTHKFHRNR 669 (669)
T ss_pred hc---cccccccccccccccccc-----------ccc---------cccccccccccccccCC
Confidence 88 477799999998651110 011 13357899999999986
|
|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2893 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5602 SIN3 Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF02671 PAH: Paired amphipathic helix repeat; InterPro: IPR003822 This family contains the paired amphipathic helix (PAH) repeat | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 663 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 43.7 bits (102), Expect = 2e-04
Identities = 40/278 (14%), Positives = 74/278 (26%), Gaps = 80/278 (28%)
Query: 388 VENIQAANRSLVERMRAAFEYDEDKYTAFKDITAQYRQGLIDTRKYLEYVKQYGLSHLVL 447
Q + ++ AF + D KD+ + ++ + + V
Sbjct: 11 TGEHQYQYKDILSVFEDAFVDNFD----CKDVQ-DMPKSILSKEEIDHIIMS---KDAVS 62
Query: 448 ELARLCPDALKQKELIETYNATLQGNNQLDNDW-----------------AHISVRAKDT 490
RL L K+ E ++ +++ + +I R +
Sbjct: 63 GTLRLF-WTLLSKQE-EMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLY 120
Query: 491 NGSKKSKGKSVA--------TEACKNDK-------------GKSTVANDSNSKHAVANNF 529
N ++ +V+ +A + GK+ VA D + V
Sbjct: 121 NDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKM 180
Query: 530 LSTVRELQSSFKPSEEDEEVLSKDGYRGAKGKSKPMVDEQLRGQNDLTSAGGGSSQTSVD 589
+ L + K E VL E L L + + D
Sbjct: 181 DFKIFWL--NLKNCNSPETVL-----------------EML---QKLLYQIDPNWTSRSD 218
Query: 590 RGGGGKQRKKTSKFHRVRLGDGSMA------ALLDLKN 621
K R + + RL + LL L N
Sbjct: 219 HSSNIKLRIHSIQAELRRL----LKSKPYENCLLVLLN 252
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 663 | |||
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.2 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.18 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.1 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.08 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.03 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.96 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 98.95 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.94 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.94 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.93 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.9 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.9 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.87 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.86 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.85 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.81 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.8 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.8 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.78 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.78 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.78 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.77 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 98.75 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.75 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.72 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.59 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.51 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.51 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 98.51 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 98.51 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.46 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.45 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.45 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.41 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.39 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.39 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.38 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.34 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.33 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.33 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.32 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 98.28 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.27 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.27 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.26 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.17 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.15 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.15 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.15 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.11 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.11 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.09 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.08 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.07 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 98.07 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.04 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.99 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 97.96 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 97.96 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.94 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 97.93 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.91 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 97.91 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.9 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 97.9 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 97.89 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.89 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 97.88 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 97.88 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 97.88 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 97.87 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 97.86 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 97.84 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 97.8 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 97.8 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 97.78 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 97.77 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.72 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 97.67 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.66 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 97.56 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 97.54 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.53 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 97.4 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 97.4 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 97.34 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 97.31 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.24 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.22 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.2 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.19 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.18 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.18 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.15 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.15 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.15 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.14 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.14 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.14 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.14 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.14 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.13 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.13 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 97.13 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.13 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.13 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.13 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.12 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.11 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.09 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.09 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.09 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.09 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.08 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.08 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.08 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.07 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.07 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.06 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.06 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.05 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.05 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.03 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.03 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.03 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.03 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.03 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.03 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.03 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.02 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.02 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.02 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.02 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.01 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.01 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.0 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.0 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.0 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.0 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.0 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.99 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.99 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.98 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.98 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.98 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.97 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.97 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.97 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.96 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.96 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.96 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.96 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.95 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.95 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.94 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.94 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.92 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.92 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 96.92 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.92 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.92 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.91 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.91 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.91 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.91 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.89 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.88 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.88 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 96.87 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.87 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.87 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.87 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.87 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.86 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.85 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.84 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.83 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 96.83 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.83 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.81 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.81 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.81 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.81 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.8 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 96.8 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.79 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.79 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.77 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.77 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.76 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.76 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.75 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.75 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.74 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.74 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.73 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.72 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 96.72 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.71 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.7 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.65 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.65 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.64 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.64 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.63 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 96.62 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.61 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.6 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 96.6 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.59 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 96.58 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.57 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.57 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.57 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 96.56 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.56 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.55 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.55 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.54 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.52 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.52 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.51 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.5 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.5 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.48 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.46 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.46 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.46 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 96.45 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.44 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.44 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.42 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 96.41 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.41 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.38 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 96.36 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.34 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.33 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.33 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 96.31 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.3 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.28 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.27 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.26 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.24 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.23 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 96.22 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 96.21 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 96.2 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.2 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.19 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.18 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.17 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 96.17 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.16 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 96.16 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.16 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.16 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 96.14 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.14 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.12 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.12 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.11 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.09 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.07 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.05 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 96.05 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.03 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.03 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.03 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 96.02 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.01 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.01 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 96.0 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 95.99 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 95.99 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 95.97 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 95.97 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 95.97 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 95.96 | |
| 2cr7_A | 80 | Paired amphipathic helix protein SIN3B; paired amp | 95.96 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 95.96 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.95 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.95 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 95.94 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 95.94 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.93 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 95.93 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 95.92 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.92 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.91 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 95.91 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 95.9 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.89 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.88 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 95.88 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 95.86 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 95.85 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 95.85 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 95.83 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.81 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 95.77 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.75 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.73 | |
| 2czy_A | 77 | Paired amphipathic helix protein SIN3B; SIN3, PAH1 | 95.73 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 95.72 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 95.7 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 95.69 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 95.63 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 95.63 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.63 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 95.61 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.54 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 95.52 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.49 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 95.44 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 95.42 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 95.42 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 95.21 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 95.2 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 95.12 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 95.11 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 95.04 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 95.01 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.99 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 93.68 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 94.62 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 94.5 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.38 | |
| 1e91_A | 85 | Paired amphipathic helix protein SIN3B; eukaryotic | 94.38 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 94.33 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.25 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.19 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.19 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.11 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.09 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 93.12 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.05 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 94.03 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.0 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 93.99 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.94 | |
| 1g1e_B | 89 | SIN3A; four-helix bundle, protein-peptide complex, | 93.76 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 93.57 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 93.55 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.41 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.39 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.36 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 92.45 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.29 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 93.18 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.15 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.14 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 92.95 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.1 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.76 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 92.76 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 92.51 | |
| 2f05_A | 105 | Paired amphipathic helix protein SIN3B; helix bund | 92.32 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.96 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 91.85 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.21 | |
| 2elu_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.75 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 90.71 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 90.53 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 90.37 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 89.04 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 87.15 | |
| 2ld7_B | 75 | Paired amphipathic helix protein SIN3A; transcript | 87.04 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 85.09 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 81.82 |
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
Probab=99.20 E-value=1.7e-11 Score=104.39 Aligned_cols=77 Identities=25% Similarity=0.550 Sum_probs=71.5
Q ss_pred CCCcCCCCCCccCCchhHHhhhc----CCCccCCCCCCCCCCCccccCCchhhhccccc----cceecCccccCcccccc
Q 006039 23 GHPMCEFCRTPFYGDNELYTHMS----TEHYTCHICQRQHPGQYEYYKNYDDLEIHFRR----DHFLCEDEACLAKKFVV 94 (663)
Q Consensus 23 GHP~C~fC~KrF~d~deL~~HmR----eKHf~C~iC~k~~~~k~~YF~~~~~LekH~R~----khf~Ce~~~C~kkKfVV 94 (663)
..+.|.+|++.|.....|..|++ +++|.|.+|++. |.....|..|++. ++|.|.. |.+.
T Consensus 16 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~-------f~~~~~l~~H~~~h~~~~~~~C~~--C~~~---- 82 (106)
T 2ee8_A 16 KEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKA-------FRRQDHLRDHRYIHSKEKPFKCQE--CGKG---- 82 (106)
T ss_dssp CCCBCSSSCCBCSSHHHHHHHHHHHCCSCCCBCSSSCCB-------CSCHHHHHHHGGGSCCCCTTSCSS--SCCC----
T ss_pred cCeECCCCCCccCCHHHHHHHHHHcCCCCCcCCCCccch-------hCCHHHHHHHHHHhCCCCCeECCC--cCCc----
Confidence 34689999999999999999998 689999999999 9999999999876 6899999 9998
Q ss_pred cccchhhhcccccccCCC
Q 006039 95 FQSEAEMKRHNAIEHGGR 112 (663)
Q Consensus 95 F~sesdLk~H~r~HHGek 112 (663)
|.+...|..|++.|++++
T Consensus 83 f~~~~~L~~H~~~H~~~~ 100 (106)
T 2ee8_A 83 FCQSRTLAVHKTLHMQTS 100 (106)
T ss_dssp CSSHHHHHHHHHHTTSCC
T ss_pred ccCHHHHHHHHHHhCCCC
Confidence 999999999999999886
|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cr7_A Paired amphipathic helix protein SIN3B; paired amphipathic helix repeat, transcriptional repressor, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rmr_A 2rms_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2czy_A Paired amphipathic helix protein SIN3B; SIN3, PAH1, transcriptional repressor, gene regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1e91_A Paired amphipathic helix protein SIN3B; eukaryotic transcriptional regulation, SIN3, PAH domains, protein-protein interactions; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1pd7_A | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g1e_B SIN3A; four-helix bundle, protein-peptide complex, transcription; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1s5q_B 1s5r_B 2l9s_B | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2f05_A Paired amphipathic helix protein SIN3B; helix bundle, transcription repressor; NMR {Mus musculus} SCOP: a.59.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2ld7_B Paired amphipathic helix protein SIN3A; transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 663 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.38 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.2 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.53 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.46 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.46 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.36 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 97.36 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 97.28 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.28 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.16 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.1 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.06 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.9 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.88 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.86 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 96.85 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 96.66 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.64 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.57 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 96.42 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 96.36 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 96.28 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 96.26 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.25 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 96.17 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.12 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.01 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 95.95 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 95.95 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 95.86 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 95.81 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.69 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.69 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.75 | |
| d2f05a1 | 85 | Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | 94.31 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 93.89 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.85 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 93.68 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.51 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 93.35 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 93.15 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 93.05 | |
| d1s5qb_ | 89 | Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | 92.86 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 92.38 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 92.13 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.87 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.8 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 91.19 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.08 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 90.52 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.94 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 89.29 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 88.84 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 88.34 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 88.09 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 87.01 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 86.93 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 86.57 | |
| d1wira_ | 121 | Protein arginine N-methyltransferase 3 {Mouse (Mus | 85.83 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 85.2 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 85.07 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 84.97 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 84.82 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 84.78 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 84.42 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 84.16 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 84.04 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 83.64 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 83.14 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 83.07 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.14 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 81.6 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.38 E-value=2.7e-08 Score=76.15 Aligned_cols=49 Identities=20% Similarity=0.515 Sum_probs=32.6
Q ss_pred CCCccCCCCCCCCCCCccccCCchhhhccccc----cceecCccccCcccccccccchhhhcccccc
Q 006039 46 TEHYTCHICQRQHPGQYEYYKNYDDLEIHFRR----DHFLCEDEACLAKKFVVFQSEAEMKRHNAIE 108 (663)
Q Consensus 46 eKHf~C~iC~k~~~~k~~YF~~~~~LekH~R~----khf~Ce~~~C~kkKfVVF~sesdLk~H~r~H 108 (663)
||+|.|. |++. |.....|..|+++ ++|.|.. |++. |.....|..|+++|
T Consensus 1 EK~y~C~-Cgk~-------F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~----F~~~~~L~~H~r~H 53 (53)
T d2csha1 1 DKLYPCQ-CGKS-------FTHKSQRDRHMSMHLGLRPYGCGV--CGKK----FKMKHHLVGHMKIH 53 (53)
T ss_dssp CCCEECT-TSCE-------ESSHHHHHHHHHHHSCCCSEECTT--TSCE----ESSSHHHHHHHTTT
T ss_pred CcCCCCC-CCCe-------ECCHHHhHHHhhccccccCCcCCC--cCCE----ecCHHHHHHHHhcC
Confidence 4666663 6666 6666666666554 6677766 7766 77777777777665
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f05a1 a.59.1.1 (A:1-85) Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|