Citrus Sinensis ID: 006130
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 660 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VZD4 | 709 | Glyoxysomal processing pr | yes | no | 0.930 | 0.866 | 0.541 | 0.0 | |
| Q2T9J0 | 566 | Peroxisomal leader peptid | yes | no | 0.198 | 0.231 | 0.379 | 7e-15 | |
| Q9DBA6 | 568 | Peroxisomal leader peptid | yes | no | 0.140 | 0.163 | 0.418 | 4e-12 | |
| P45129 | 466 | Probable periplasmic seri | yes | no | 0.183 | 0.259 | 0.323 | 2e-06 | |
| P39099 | 455 | Periplasmic pH-dependent | N/A | no | 0.292 | 0.424 | 0.272 | 2e-05 | |
| P26982 | 475 | Periplasmic serine endopr | yes | no | 0.186 | 0.258 | 0.326 | 3e-05 | |
| P0C0V0 | 474 | Periplasmic serine endopr | N/A | no | 0.186 | 0.259 | 0.326 | 3e-05 | |
| P0C0V1 | 474 | Periplasmic serine endopr | N/A | no | 0.186 | 0.259 | 0.326 | 3e-05 | |
| P57322 | 478 | Probable serine protease | yes | no | 0.171 | 0.236 | 0.312 | 3e-05 | |
| O85291 | 478 | Probable periplasmic seri | yes | no | 0.178 | 0.246 | 0.291 | 0.0004 |
| >sp|Q8VZD4|DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana GN=DEG15 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 664 bits (1712), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 364/672 (54%), Positives = 457/672 (68%), Gaps = 58/672 (8%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLS-FFDTK 59
M + ++ FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG TLSASG+LLP F +
Sbjct: 1 MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60
Query: 60 VAERNWGVNG----LIVTVASVVEPFLLPQYRDKDTSEGQP-ELITGSQIDFLVEGKLRS 114
VA + G L++TVASVVEPFL +R + P +LI G+ I+ +VEG+L+S
Sbjct: 61 VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSSISQDPVKLIPGAMIEIMVEGQLKS 120
Query: 115 EKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSS 174
EKE +P WV AQL+ LVD+PVSS ALQSL+EASSG + W++GWSL N S
Sbjct: 121 EKE-------APFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGS 173
Query: 175 QPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIAL 234
QP +IE LM+ ++E N + M+KS +R+AILGV L P++
Sbjct: 174 QP-----SINIEHYSKPLMQ------LDEPHNANFMAKSATRMAILGVPLSLLGQPSMNF 222
Query: 235 TPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEG 294
+ +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP S +SL++AD+RCLPGMEG
Sbjct: 223 ASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEG 282
Query: 295 GPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKG 353
PVF ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP
Sbjct: 283 APVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP------------ 330
Query: 354 NLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLL 413
+ G + + S +L+ D+ + + I+KA+ SVCLIT++DGVWASG++L
Sbjct: 331 --SVEGKASQWGSEVLSVKS-------DASIPAQVAIEKAMESVCLITVNDGVWASGIIL 381
Query: 414 NDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQP-----EDSASSGHTGVDQYQKSQTLP 468
N+ GLILTNAHLLEPWR+GK G G F+P E+ +S+G +Q KSQTLP
Sbjct: 382 NEHGLILTNAHLLEPWRYGK----GGVYGEGFKPYVLGAEEFSSTGSKFWEQ--KSQTLP 435
Query: 469 PKMPKIVDSSVDEH-RAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLL 527
K P+ SSV E+ R YK + GHR IRVRL HLD W WC A +VY+CK LD++LL
Sbjct: 436 RKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTWCPANVVYICKEQLDIALL 495
Query: 528 QLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYG 587
QL Y+P +L PI A+F P LG+ A+V+GHGLFGPRCGLSPS+ SGVVAKVV A
Sbjct: 496 QLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNT 555
Query: 588 QSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIP 647
QS Q + +P MLETTAAVHPGGSGGAV+N GHMIGLVTSNARHG GTVIPHLNFSIP
Sbjct: 556 QSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVTSNARHGAGTVIPHLNFSIP 615
Query: 648 CAVLRPIFEFAR 659
CAVL PIF+FA
Sbjct: 616 CAVLAPIFKFAE 627
|
Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens GN=TYSND1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus GN=Tysnd1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P45129|HTOA_HAEIN Probable periplasmic serine protease do/HhoA-like OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1259 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P39099|DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ OS=Escherichia coli (strain K12) GN=degQ PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P26982|DEGP_SALTY Periplasmic serine endoprotease DegP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0C0V1|DEGP_ECO57 Periplasmic serine endoprotease DegP OS=Escherichia coli O157:H7 GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P57322|DEGP_BUCAI Probable serine protease do-like OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=degP PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O85291|DEGPL_BUCAP Probable periplasmic serine endoprotease DegP-like OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=htrA PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 660 | ||||||
| 224077082 | 752 | predicted protein [Populus trichocarpa] | 0.984 | 0.864 | 0.664 | 0.0 | |
| 224125536 | 716 | predicted protein [Populus trichocarpa] | 0.953 | 0.878 | 0.658 | 0.0 | |
| 359483482 | 753 | PREDICTED: LOW QUALITY PROTEIN: glyoxyso | 0.980 | 0.859 | 0.611 | 0.0 | |
| 255536763 | 729 | trypsin domain-containing protein, putat | 0.951 | 0.861 | 0.615 | 0.0 | |
| 297740411 | 682 | unnamed protein product [Vitis vinifera] | 0.881 | 0.853 | 0.573 | 0.0 | |
| 356546634 | 749 | PREDICTED: glyoxysomal processing protea | 0.974 | 0.858 | 0.573 | 0.0 | |
| 111183165 | 753 | putative protease/hydrolase [Solanum lyc | 0.986 | 0.864 | 0.540 | 0.0 | |
| 357446685 | 819 | Peroxisomal leader peptide-processing pr | 0.987 | 0.796 | 0.525 | 0.0 | |
| 297851284 | 713 | hypothetical protein ARALYDRAFT_473044 [ | 0.936 | 0.866 | 0.537 | 0.0 | |
| 18086453 | 709 | At1g28320/F3H9_2 [Arabidopsis thaliana] | 0.930 | 0.866 | 0.543 | 0.0 |
| >gi|224077082|ref|XP_002305124.1| predicted protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 858 bits (2216), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 447/673 (66%), Positives = 527/673 (78%), Gaps = 23/673 (3%)
Query: 1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKV 60
MGLPE+ +F+RNF V+VR+QGPDPKGLKMR+HAFHQYNSGKTTLSASG+LLP + +D +
Sbjct: 1 MGLPEIVDFARNFAVMVRIQGPDPKGLKMRKHAFHQYNSGKTTLSASGLLLPDTLYDADL 60
Query: 61 AER-----NWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK--LR 113
A R + G+ GL+VTVASV+EPFL ++R+ S+ +PELI G+QID + EGK LR
Sbjct: 61 ANRILEGKSQGL-GLVVTVASVIEPFLSSKHRES-ISQSRPELIPGAQIDVMAEGKSDLR 118
Query: 114 SEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNS 173
+ + +DKG+ W+ AQ++ LVD+P+SSLALQSL+EASSG H WEVGWSLA N
Sbjct: 119 NGADG-GLDKGTSHWLRAQVIRLVDVPLSSLALQSLVEASSGSMNHGWEVGWSLASPENG 177
Query: 174 SQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIA 233
SQ M VV+T E S+ ES R A EESSN S+M KST+RVAILGV +LKDLPN
Sbjct: 178 SQSFMDVVQTQTEHGNASIAESQR-RAREESSNPSIMGKSTTRVAILGVFLHLKDLPNFE 236
Query: 234 LTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGME 293
++ ++RGD LLAVGSPFGVLSP+HFFNS+S+GS+ANCYPPRS+ SLLMADIRCLPGME
Sbjct: 237 ISASSRRGDFLLAVGSPFGVLSPVHFFNSLSVGSIANCYPPRSSDISLLMADIRCLPGME 296
Query: 294 GGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINK 352
G PVF E+++F+GILIRPLRQKS GAEIQLVIPWEAIA ACSDLLLKEPQNAEK IHINK
Sbjct: 297 GSPVFCENSNFIGILIRPLRQKSSGAEIQLVIPWEAIALACSDLLLKEPQNAEKGIHINK 356
Query: 353 GNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVL 412
NLNAVGN+ +S +G K+EH S C SP P++KA+AS+CLITID+ VWASGVL
Sbjct: 357 ENLNAVGNAYSSSS---DGPFPLKHEHHISYCSSPPPVEKAMASICLITIDELVWASGVL 413
Query: 413 LNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQ-----PEDSASSGHTGVDQYQKSQTL 467
LNDQGLILTNAHLLEPWRFGKTTV+G +G Q PE+ ++ VD ++K+Q L
Sbjct: 414 LNDQGLILTNAHLLEPWRFGKTTVNGGEDGTKLQDPFIPPEEFPR--YSEVDGHEKTQRL 471
Query: 468 PPKMPKIVDSSV-DEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSL 526
PPK I++SSV DE + YKLS +G IRVRLDH DPWIWCDAK+V+VCKGPLDV+L
Sbjct: 472 PPKTLNIMNSSVADESKGYKLSLSYKGPMNIRVRLDHADPWIWCDAKVVHVCKGPLDVAL 531
Query: 527 LQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSY 586
LQL ++PDQL P DF SLGS AYVIGHGLFGPRCG SPS+ SG V+KVVKA PSY
Sbjct: 532 LQLEHVPDQLFPTKVDFECSSLGSKAYVIGHGLFGPRCGFSPSICSGAVSKVVKAKAPSY 591
Query: 587 GQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLNFSI 646
QS S P MLETTAAVHPGGSGGAVVN +GHMIGLVTS ARHGGGTVIPHLNFSI
Sbjct: 592 CQSVQGGYSHIPAMLETTAAVHPGGSGGAVVNSEGHMIGLVTSKARHGGGTVIPHLNFSI 651
Query: 647 PCAVLRPIFEFAR 659
PCAVL PIF+FA+
Sbjct: 652 PCAVLAPIFDFAK 664
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224125536|ref|XP_002329829.1| predicted protein [Populus trichocarpa] gi|222870891|gb|EEF08022.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359483482|ref|XP_002273997.2| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal processing protease, glyoxysomal-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536763|ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297740411|emb|CBI30593.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356546634|ref|XP_003541729.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|357446685|ref|XP_003593618.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] gi|355482666|gb|AES63869.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297851284|ref|XP_002893523.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] gi|297339365|gb|EFH69782.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18086453|gb|AAL57680.1| At1g28320/F3H9_2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 660 | ||||||
| TAIR|locus:2032142 | 709 | DEG15 "degradation of periplas | 0.412 | 0.383 | 0.577 | 4.4e-154 | |
| DICTYBASE|DDB_G0279049 | 849 | DDB_G0279049 "trypsin-like ser | 0.118 | 0.091 | 0.417 | 1.4e-25 | |
| ZFIN|ZDB-GENE-030131-8525 | 565 | tysnd1 "trypsin domain contain | 0.140 | 0.164 | 0.384 | 1.1e-22 | |
| UNIPROTKB|Q2T9J0 | 566 | TYSND1 "Peroxisomal leader pep | 0.198 | 0.231 | 0.339 | 9e-21 | |
| UNIPROTKB|F1SUE6 | 568 | TYSND1 "Uncharacterized protei | 0.198 | 0.230 | 0.313 | 1.9e-18 | |
| MGI|MGI:1919017 | 568 | Tysnd1 "trypsin domain contain | 0.190 | 0.221 | 0.335 | 4.8e-18 | |
| RGD|1307354 | 567 | Tysnd1 "trypsin domain contain | 0.190 | 0.222 | 0.315 | 5.4e-18 | |
| UNIPROTKB|J9P6K2 | 198 | TYSND1 "Uncharacterized protei | 0.196 | 0.656 | 0.331 | 7.9e-11 | |
| UNIPROTKB|E1BF31 | 565 | E1BF31 "Uncharacterized protei | 0.134 | 0.157 | 0.383 | 1.9e-10 | |
| UNIPROTKB|G3MYB0 | 569 | G3MYB0 "Uncharacterized protei | 0.134 | 0.156 | 0.383 | 2.7e-09 |
| TAIR|locus:2032142 DEG15 "degradation of periplasmic proteins 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 799 (286.3 bits), Expect = 4.4e-154, Sum P(2) = 4.4e-154
Identities = 164/284 (57%), Positives = 197/284 (69%)
Query: 381 DSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWR 440
D+ + + I+KA+ SVCLIT++DGVWASG++LN+ GLILTNAHLLEPWR+GK V G
Sbjct: 349 DASIPAQVAIEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYG-- 406
Query: 441 NGVSFQP-----EDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEH-RAYKLSSFSRGH 494
G F+P E+ +S+G +Q KSQTLP K P+ SSV E+ R YK + GH
Sbjct: 407 EG--FKPYVLGAEEFSSTGSKFWEQ--KSQTLPRKAPRNHYSSVGENIREYKHNFLQTGH 462
Query: 495 RKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYV 554
R IRVRL HLD W WC A +VY+CK LD++LLQL Y+P +L PI A+F P LG+ A+V
Sbjct: 463 RDIRVRLCHLDSWTWCPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHV 522
Query: 555 IGHGLFGPRCGLXXXXXXXXXXXXXXXNLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGG 614
+GHGLFGPRCGL QS Q + +P MLETTAAVHPGGSGG
Sbjct: 523 VGHGLFGPRCGLSPSICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGG 582
Query: 615 AVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFA 658
AV+N GHMIGLVTSNARHG GTVIPHLNFSIPCAVL PIF+FA
Sbjct: 583 AVLNSSGHMIGLVTSNARHGAGTVIPHLNFSIPCAVLAPIFKFA 626
|
|
| DICTYBASE|DDB_G0279049 DDB_G0279049 "trypsin-like serine protease family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-8525 tysnd1 "trypsin domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9J0 TYSND1 "Peroxisomal leader peptide-processing protease" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUE6 TYSND1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919017 Tysnd1 "trypsin domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307354 Tysnd1 "trypsin domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P6K2 TYSND1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF31 E1BF31 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MYB0 G3MYB0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8VZD4 | DEG15_ARATH | 3, ., 4, ., 2, 1, ., - | 0.5416 | 0.9303 | 0.8660 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.00040486 | hypothetical protein (752 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 660 | |||
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 1e-07 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 6e-07 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 1e-05 | |
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 2e-05 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 3e-05 | |
| TIGR02038 | 351 | TIGR02038, protease_degS, periplasmic serine pepet | 2e-04 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 0.004 |
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Score = 51.0 bits (122), Expect = 1e-07
Identities = 29/117 (24%), Positives = 44/117 (37%), Gaps = 15/117 (12%)
Query: 510 CDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGLSPS 569
A++V LD++LL++ P+ A P GS V G G G
Sbjct: 37 VPAEVVAADPD-LDLALLKVDGPLLPAAPLLASSAAPLGGSVVVVGGPGGIGLGASGGGG 95
Query: 570 VSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGL 626
G+V+ + Y + T A PG SGG V + DG ++G+
Sbjct: 96 GVGGLVSGSLGGVDGRY--------------ILTDADTSPGSSGGPVFDADGEVVGI 138
|
This family includes trypsin like peptidase domains. Length = 138 |
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 660 | |||
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.95 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.95 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.95 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.93 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.93 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.91 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 99.88 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 99.86 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 99.85 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.84 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.82 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 99.81 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.54 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.34 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.34 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.31 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.21 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 99.01 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 98.87 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.24 | |
| KOG3627 | 256 | consensus Trypsin [Amino acid transport and metabo | 98.22 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 98.14 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 97.8 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 97.1 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 96.75 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 96.61 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 96.6 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 94.96 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 94.94 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 94.58 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 94.13 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 92.83 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 91.37 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 90.3 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 90.16 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 89.63 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 89.43 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 86.48 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 85.98 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 85.12 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 84.95 | |
| PF00947 | 127 | Pico_P2A: Picornavirus core protein 2A; InterPro: | 84.62 | |
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 83.71 | |
| PF05580 | 218 | Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR | 82.67 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 80.34 |
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.2e-26 Score=250.35 Aligned_cols=187 Identities=26% Similarity=0.438 Sum_probs=151.0
Q ss_pred hhHHhhccCceEEEEeCC-----------CeEEEEEEEeCCCEEEEcccccCCCCCcceeecCCccccccCCCCCCCCCC
Q 006130 387 PLPIQKALASVCLITIDD-----------GVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGH 455 (660)
Q Consensus 387 p~~i~~a~~SVV~I~~~~-----------~~wGSGflI~~~GlILTNaHVVep~~~~~~~~~g~~~~~~f~~~~~~~~~~ 455 (660)
..+++++.+|||.|.... ...||||+|+++||||||+||++ +
T Consensus 48 ~~~~~~~~psVV~I~~~~~~~~~~~~~~~~~~GSG~vi~~~G~IlTn~HVV~----------~----------------- 100 (351)
T TIGR02038 48 NKAVRRAAPAVVNIYNRSISQNSLNQLSIQGLGSGVIMSKEGYILTNYHVIK----------K----------------- 100 (351)
T ss_pred HHHHHhcCCcEEEEEeEeccccccccccccceEEEEEEeCCeEEEecccEeC----------C-----------------
Confidence 356899999999997621 34799999999999999999996 1
Q ss_pred CcccccccccCCCCCCCcccccccccccccccccccCCceeEEEEEcCCCcceeEeeEEEEecCCCCceEEEEEccCCCC
Q 006130 456 TGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQ 535 (660)
Q Consensus 456 ~~~~~~~~~~~~~~k~~~i~~e~~~~~~~~~~n~~~~~~~~I~Vr~~~~~~~~w~~A~VV~v~d~~~DLALLqL~~~p~~ 535 (660)
.+.+.|++.+++. ++|++++ .|+..||||||++. ..
T Consensus 101 --------------------------------------~~~i~V~~~dg~~---~~a~vv~-~d~~~DlAvlkv~~--~~ 136 (351)
T TIGR02038 101 --------------------------------------ADQIVVALQDGRK---FEAELVG-SDPLTDLAVLKIEG--DN 136 (351)
T ss_pred --------------------------------------CCEEEEEECCCCE---EEEEEEE-ecCCCCEEEEEecC--CC
Confidence 2237788888765 9999999 78889999999996 34
Q ss_pred cceeecCCC-CCCCCCeEEEEecCCCCCCCCCCCeeeeeEEeeeeeccCCCCCccccccCCCcCcEEEEcccccCCcccc
Q 006130 536 LCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGG 614 (660)
Q Consensus 536 l~pi~l~~s-~~~~Gd~V~vIGygl~g~~~gl~psvt~GiVS~v~~~~~~~~~~~~~~~~~~~~~~IqTda~v~~G~SGG 614 (660)
++++++.++ .+++||.|+++|| |+++..+++.|+|++..+... .......+||||+++.+|||||
T Consensus 137 ~~~~~l~~s~~~~~G~~V~aiG~-----P~~~~~s~t~GiIs~~~r~~~---------~~~~~~~~iqtda~i~~GnSGG 202 (351)
T TIGR02038 137 LPTIPVNLDRPPHVGDVVLAIGN-----PYNLGQTITQGIISATGRNGL---------SSVGRQNFIQTDAAINAGNSGG 202 (351)
T ss_pred CceEeccCcCccCCCCEEEEEeC-----CCCCCCcEEEEEEEeccCccc---------CCCCcceEEEECCccCCCCCcc
Confidence 778888764 6899999999999 466778999999998764321 0112346799999999999999
Q ss_pred cccccCceEEEEeeecccCCCCcccCceEEEEehHHHHHHHHHh
Q 006130 615 AVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFA 658 (660)
Q Consensus 615 PL~Ns~G~VVGIvssna~~~~g~~ip~lnFaIPi~~l~~il~~a 658 (660)
||||.+|+||||+++.....++....+++|+||++.++++++.+
T Consensus 203 pl~n~~G~vIGI~~~~~~~~~~~~~~g~~faIP~~~~~~vl~~l 246 (351)
T TIGR02038 203 ALINTNGELVGINTASFQKGGDEGGEGINFAIPIKLAHKIMGKI 246 (351)
T ss_pred eEECCCCeEEEEEeeeecccCCCCccceEEEecHHHHHHHHHHH
Confidence 99999999999999876543333335799999999999999765
|
This family consists of the periplasmic serine protease DegS (HhoB), a shorter paralog of protease DO (HtrA, DegP) and DegQ (HhoA). It is found in E. coli and several other Proteobacteria of the gamma subdivision. It contains a trypsin domain and a single copy of PDZ domain (in contrast to DegP with two copies). A critical role of this DegS is to sense stress in the periplasm and partially degrade an inhibitor of sigma(E). |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3627 consensus Trypsin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 660 | ||||
| 3stj_A | 345 | Crystal Structure Of The Protease + Pdz1 Domain Of | 7e-04 | ||
| 3sti_A | 245 | Crystal Structure Of The Protease Domain Of Degq Fr | 8e-04 | ||
| 3mh5_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 9e-04 | ||
| 2zle_A | 448 | Cryo-Em Structure Of Degp12OMP Length = 448 | 9e-04 |
| >pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 | Back alignment and structure |
|
| >pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 68.7 bits (167), Expect = 4e-12
Identities = 81/609 (13%), Positives = 184/609 (30%), Gaps = 160/609 (26%)
Query: 57 DTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK----- 111
D + E + ++ SV E + + KD + +++ +ID ++ K
Sbjct: 8 DFETGEHQYQYKDIL----SVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63
Query: 112 -------LRSEKEH------EDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPE 158
L S++E E+V + + +++ + + P S+ + +E L
Sbjct: 64 TLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP--SMMTRMYIEQRDRL-- 119
Query: 159 HEWEVGWSLAPYNNSSQPLMGVVKTSIE---------------SNKISLMESHRPFAMEE 203
+ A YN S ++ ++ S K + A++
Sbjct: 120 --YNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWV-------ALDV 170
Query: 204 SSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVL-----SPMH 258
+ + K ++ L + + P L L K LL + + +
Sbjct: 171 CLSYKVQCKMDFKIFWLNLKNCNS--PETVLEMLQK---LLYQIDPNWTSRSDHSSNIKL 225
Query: 259 FFNSVSMGSVANCYPPRSTTRSLLMAD------------IRC--------------LPGM 292
+S+ + + LL+ + C L
Sbjct: 226 RIHSIQ-AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAA 284
Query: 293 EGGPVFGEH--------------AHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL 338
+ +H ++ + L + E+ P ++ ++ +
Sbjct: 285 TTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPR-RLSI-IAESIR 338
Query: 339 KEPQNAEKEIHINKGNLN-AVGNSL-LFNSHILNGACCYKY-----EHVDSRCRSPLPIQ 391
+ H+N L + +SL + + +P
Sbjct: 339 DGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRK--MFDRLSVFPPSA------HIPTI 390
Query: 392 KALASVCLITIDDGVWASGVLLNDQGLILTNAH---LLEPWRFGKTTVSGWRNGVSF--- 445
L+++ +W + +D +++ H L+E ++T+S +
Sbjct: 391 -------LLSL---IWFDVIK-SDVMVVVNKLHKYSLVEKQPK-ESTIS--IPSIYLELK 436
Query: 446 QPEDSASSGH-TGVDQYQKSQTLPP--KMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLD 502
++ + H + VD Y +T +P +D H + L + R R+
Sbjct: 437 VKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV 496
Query: 503 HLD-PWIWCDAKIVYV-----CKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIG 556
LD ++ + KI + G + +L QL + +C D + + V
Sbjct: 497 FLDFRFL--EQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYER-------LVNA 547
Query: 557 HGLFGPRCG 565
F P+
Sbjct: 548 ILDFLPKIE 556
|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 660 | |||
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.96 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.95 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.95 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.94 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.94 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.94 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.94 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.93 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.93 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.93 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.93 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.93 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.93 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.92 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.92 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 99.88 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.84 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 99.84 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.83 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.83 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.82 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.81 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.8 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.79 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.78 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.74 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.74 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.74 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.7 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.69 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.67 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.67 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.66 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.65 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.65 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.64 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.64 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.64 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.53 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.5 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.5 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.47 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.46 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.41 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.4 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.4 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.39 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.38 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.38 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.37 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.37 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.37 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.37 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.37 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.37 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.36 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 99.36 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.36 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.36 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.35 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.35 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.35 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.34 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.34 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.33 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.33 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.33 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.33 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.33 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.33 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.32 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.32 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.31 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.3 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.3 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.3 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.3 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.3 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.29 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.29 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.28 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.28 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.28 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.28 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.27 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.27 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.27 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.26 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.26 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.26 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.26 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.26 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.26 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.24 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.23 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.23 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.23 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.23 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.22 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.22 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.21 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.21 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.2 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.2 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.2 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.19 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.19 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.18 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.17 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.17 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.16 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.16 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.15 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.14 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.14 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 99.13 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.12 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.12 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.12 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 99.11 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.1 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.1 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.09 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.08 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.06 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.06 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.05 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.05 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.04 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.03 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.02 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.02 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.02 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.0 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.0 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 98.99 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.99 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 98.99 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 98.91 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 98.87 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 98.87 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 98.84 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 98.84 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 98.83 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 98.8 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 98.77 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 98.76 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.76 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 98.73 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 98.7 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.7 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 98.69 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 98.62 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.61 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 98.58 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 98.41 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.4 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 98.36 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.35 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 98.31 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.27 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 97.95 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 97.92 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 97.89 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 96.6 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 96.59 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 96.59 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 96.55 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 96.51 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 96.48 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 96.23 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 94.49 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 94.34 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 94.0 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 93.78 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 91.83 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 91.57 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 91.18 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 91.18 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 91.0 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 90.34 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 90.31 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 90.23 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 89.77 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 89.64 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 89.1 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 88.66 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 88.5 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 88.33 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 88.32 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 88.02 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 87.92 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 87.77 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 87.63 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 87.57 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 87.28 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 86.85 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 86.67 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 86.63 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 86.55 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 86.39 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 86.21 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 86.21 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 86.03 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 85.82 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 85.81 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 85.79 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 85.73 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 85.66 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 85.41 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 85.07 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 84.94 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 84.75 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 84.45 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 83.75 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 83.56 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 83.5 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 83.21 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 83.08 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 83.01 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 82.43 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 82.36 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 82.29 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 82.02 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 82.01 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 81.92 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 81.91 | |
| 2fp7_B | 172 | Serine protease NS3; flavivirus, NS3 protease, NS2 | 81.39 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 81.2 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 81.09 | |
| 1ep5_B | 157 | Capsid protein C, coat protein C; beta barrel, hyd | 80.98 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 80.97 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 80.83 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 80.79 | |
| 1vcp_A | 149 | Semliki forest virus capsid protein; virus coat pr | 80.71 | |
| 2fom_B | 185 | Polyprotein; flavivirus, NS3 protease, NS2B cofact | 80.43 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 80.31 | |
| 2ggv_B | 185 | NS3, non-structural protein 3; beta barrel, serine | 80.25 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 80.07 |
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.96 E-value=3.1e-28 Score=248.98 Aligned_cols=187 Identities=28% Similarity=0.497 Sum_probs=143.9
Q ss_pred hhHHhhccCceEEEEeCC----------------------------CeEEEEEEEeCC-CEEEEcccccCCCCCcceeec
Q 006130 387 PLPIQKALASVCLITIDD----------------------------GVWASGVLLNDQ-GLILTNAHLLEPWRFGKTTVS 437 (660)
Q Consensus 387 p~~i~~a~~SVV~I~~~~----------------------------~~wGSGflI~~~-GlILTNaHVVep~~~~~~~~~ 437 (660)
..+++++.++||.|.+.. .+.||||+|+++ ||||||+||++
T Consensus 16 ~~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfiI~~~~G~IlTnaHvv~---------- 85 (245)
T 3sti_A 16 APMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVIN---------- 85 (245)
T ss_dssp HHHHHHHGGGEEEC----------------------------------CCEEEEEETTTTEEEECGGGC-----------
T ss_pred HHHHHHhCCceEEEEEEEeeccccccchhhhhhccccccccccccccceEEEEEEeCCCCEEEEcHHHhC----------
Confidence 357899999999997631 357999999998 99999999996
Q ss_pred CCccccccCCCCCCCCCCCcccccccccCCCCCCCcccccccccccccccccccCCceeEEEEEcCCCcceeEeeEEEEe
Q 006130 438 GWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYV 517 (660)
Q Consensus 438 g~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~k~~~i~~e~~~~~~~~~~n~~~~~~~~I~Vr~~~~~~~~w~~A~VV~v 517 (660)
+ ...+.|++.+++. +++++++
T Consensus 86 ~-------------------------------------------------------a~~i~V~~~dg~~---~~a~vv~- 106 (245)
T 3sti_A 86 Q-------------------------------------------------------AQKISIQLNDGRE---FDAKLIG- 106 (245)
T ss_dssp ----------------------------------------------------------CEEEECTTSCE---EEEEEEE-
T ss_pred C-------------------------------------------------------CCEEEEEECCCCE---EEEEEEE-
Confidence 1 1226677766654 8899888
Q ss_pred cCCCCceEEEEEccCCCCcceeecCCC-CCCCCCeEEEEecCCCCCCCCCCCeeeeeEEeeeeeccCCCCCccccccCCC
Q 006130 518 CKGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPRCGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSA 596 (660)
Q Consensus 518 ~d~~~DLALLqL~~~p~~l~pi~l~~s-~~~~Gd~V~vIGygl~g~~~gl~psvt~GiVS~v~~~~~~~~~~~~~~~~~~ 596 (660)
.|+.+||||||++. +..++++.+.++ .+++|+.|+++|| |++...+++.|+|++..+.. .....
T Consensus 107 ~d~~~DlAlLkv~~-~~~~~~~~l~~s~~~~~G~~v~aiG~-----P~g~~~~vt~G~vs~~~~~~---------~~~~~ 171 (245)
T 3sti_A 107 SDDQSDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGN-----PFGLGQTATSGIVSALGRSG---------LNLEG 171 (245)
T ss_dssp EETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTBEEEEEEC-----GGGSCCEEEEEEEEECSSCS---------SCCTT
T ss_pred ecCCCCEEEEEecc-CCCCceeeecCcCCCCCCCEEEEEEC-----CCCCCCcEEeeEEeeecccc---------cCCCC
Confidence 67789999999985 567888888764 6899999999999 56777899999999875431 01123
Q ss_pred cCcEEEEcccccCCcccccccccCceEEEEeeecccCCCCcccCceEEEEehHHHHHHHHHhc
Q 006130 597 YPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFEFAR 659 (660)
Q Consensus 597 ~~~~IqTda~v~~G~SGGPL~Ns~G~VVGIvssna~~~~g~~ip~lnFaIPi~~l~~il~~a~ 659 (660)
...+|++++.+++|+|||||||.+|+||||+++.....++. .+++|+||++.++++++++.
T Consensus 172 ~~~~i~tda~i~~G~SGGPLvn~~G~vVGI~s~~~~~~~~~--~g~~faIP~~~~~~~~~~l~ 232 (245)
T 3sti_A 172 LENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGS--VGIGFAIPSNMARTLAQQLI 232 (245)
T ss_dssp CSSCEEESSCCCTTTTTSEEECTTSCEEEEEECCC--------CCCEEEEEHHHHHHHHHHHH
T ss_pred ccCEEEEcCCcCCCcchhHeecCCCeEEEEEEeEECCCCCc--ceEEEEEeHHHHHHHHHHHH
Confidence 45579999999999999999999999999999987654332 37899999999999998763
|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A | Back alignment and structure |
|---|
| >2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 660 | ||||
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 4e-11 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 0.004 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 4e-10 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 7e-06 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 6e-08 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 6e-04 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 2e-07 | |
| d2qf3a1 | 210 | b.47.1.1 (A:43-252) Stress sensor protease DegS, c | 2e-05 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 6e-05 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 1e-04 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Score = 61.5 bits (148), Expect = 4e-11
Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 17/153 (11%)
Query: 505 DPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPID-ADFGQPSLGSAAYVIGHGLFGPR 563
V K P L P L I AD +G IG+
Sbjct: 106 QLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFG--- 162
Query: 564 CGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHM 623
L +V+SG+V+ + ++ L + ++T AA++ G +GGA+VNL+G +
Sbjct: 163 --LGETVTSGIVSALGRSGLNAENYENF---------IQTDAAINRGNAGGALVNLNGEL 211
Query: 624 IGLVTSNARHGGGTVIPHLNFSIPCAVLRPIFE 656
IG+ T+ GG + + F+IP +++ +
Sbjct: 212 IGINTAILAPDGGNI--GIGFAIPSNMVKNLTS 242
|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 660 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.96 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.95 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.94 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.94 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.93 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.86 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.81 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.77 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.76 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.64 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.63 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.61 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.61 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.6 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.46 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.46 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.43 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.42 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.4 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.38 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.23 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.23 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.22 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.16 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.12 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.1 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 99.09 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.09 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 99.08 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 99.07 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 99.04 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.04 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 99.03 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.03 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 99.02 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 99.02 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.01 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 98.99 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 98.98 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 98.97 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 98.96 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 98.96 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 98.94 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 98.93 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 98.93 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 98.92 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 98.91 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 98.9 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 98.89 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.88 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 98.83 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.82 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.82 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 98.81 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.78 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 98.78 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 98.75 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 98.75 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 98.74 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 98.73 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.69 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 98.67 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 98.67 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 98.66 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.65 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.65 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 98.63 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 98.63 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.63 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 98.6 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 98.59 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 98.59 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.58 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 98.53 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 98.48 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 98.46 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 98.12 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 97.8 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 97.36 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 97.29 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 97.01 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 94.62 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 94.38 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 90.1 | |
| d2fomb1 | 150 | NS3 protease {Dengue virus type 2 [TaxId: 11060]} | 84.91 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 84.18 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 83.7 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 83.47 | |
| d2fp7b1 | 152 | NS3 protease {West nile virus [TaxId: 11082]} | 82.98 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 80.84 | |
| g1dy9.1 | 187 | NS3 protease {Human hepatitis C virus (HCV), diffe | 80.67 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 80.09 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=3.4e-28 Score=246.66 Aligned_cols=167 Identities=30% Similarity=0.525 Sum_probs=135.9
Q ss_pred eEEEEEEEeCC-CEEEEcccccCCCCCcceeecCCccccccCCCCCCCCCCCcccccccccCCCCCCCcccccccccccc
Q 006130 406 VWASGVLLNDQ-GLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRA 484 (660)
Q Consensus 406 ~wGSGflI~~~-GlILTNaHVVep~~~~~~~~~g~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~k~~~i~~e~~~~~~~ 484 (660)
+.||||+|+++ ||||||+||++ +
T Consensus 76 ~~GSG~iI~~~~g~IlTn~HVv~----------~---------------------------------------------- 99 (249)
T d1ky9a2 76 ALGSGVIIDADKGYVVTNNHVVD----------N---------------------------------------------- 99 (249)
T ss_dssp EEEEEEEEETTTTEEEEEHHHHT----------T----------------------------------------------
T ss_pred ccccEEEEeccCceEEeeccccc----------c----------------------------------------------
Confidence 36999999875 89999999997 1
Q ss_pred cccccccCCceeEEEEEcCCCcceeEeeEEEEecCCCCceEEEEEccCCCCcceeecCCC-CCCCCCeEEEEecCCCCCC
Q 006130 485 YKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFG-QPSLGSAAYVIGHGLFGPR 563 (660)
Q Consensus 485 ~~~n~~~~~~~~I~Vr~~~~~~~~w~~A~VV~v~d~~~DLALLqL~~~p~~l~pi~l~~s-~~~~Gd~V~vIGygl~g~~ 563 (660)
...+.+++.+++. +.|+++. .|...|+|||+++. +..++++++.++ .+++||.|+++|| |
T Consensus 100 ---------~~~~~v~~~~~~~---~~a~~~~-~d~~~dlavl~i~~-~~~~~~~~l~~~~~~~~G~~v~aiG~-----P 160 (249)
T d1ky9a2 100 ---------ATVIKVQLSDGRK---FDAKMVG-KDPRSDIALIQIQN-PKNLTAIKMADSDALRVGDYTVAIGN-----P 160 (249)
T ss_dssp ---------EEEEEEEETTSCE---EEEEEEE-EETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTCEEEEEEC-----T
T ss_pred ---------ceeeeeeeccccc---ccceeeE-eccchhhceeeecc-cccceEEEcCCcCcCCcCCEEEEEec-----c
Confidence 2346777777765 8999998 67779999999986 567899999875 5999999999999 5
Q ss_pred CCCCCeeeeeEEeeeeeccCCCCCccccccCCCcCcEEEEcccccCCcccccccccCceEEEEeeecccCCCCcccCceE
Q 006130 564 CGLSPSVSSGVVAKVVKANLPSYGQSTLQRNSAYPVMLETTAAVHPGGSGGAVVNLDGHMIGLVTSNARHGGGTVIPHLN 643 (660)
Q Consensus 564 ~gl~psvt~GiVS~v~~~~~~~~~~~~~~~~~~~~~~IqTda~v~~G~SGGPL~Ns~G~VVGIvssna~~~~g~~ip~ln 643 (660)
+++..+++.|+++....... .......+||||+++++|||||||||.+|+||||+++.....++. .+++
T Consensus 161 ~g~~~tvt~~~~~~~~~~~~---------~~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~--~gi~ 229 (249)
T d1ky9a2 161 FGLGETVTSGIVSALGRSGL---------NAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGN--IGIG 229 (249)
T ss_dssp TSSSCEEEEEEEEEESSCC--------------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCC--SSSE
T ss_pred cccCCceeecceeecccccc---------cCccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCc--ccEE
Confidence 67888999999987654311 113345579999999999999999999999999999987765443 3789
Q ss_pred EEEehHHHHHHHHHh
Q 006130 644 FSIPCAVLRPIFEFA 658 (660)
Q Consensus 644 FaIPi~~l~~il~~a 658 (660)
|+||++.++++++.+
T Consensus 230 faIP~~~~~~~~~~l 244 (249)
T d1ky9a2 230 FAIPSNMVKNLTSQM 244 (249)
T ss_dssp EEEEHHHHHHHHHHH
T ss_pred EEEEHHHHHHHHHHH
Confidence 999999999998875
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|