Citrus Sinensis ID: 006153

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66

MANDTGLDFSDQIVSLENKYQQALKDLYTHLTPIQRVNIARHPNRPTFLDHVFNITEKFVELHGDRAGYDDPAIVTGIGSMDGRTYMFMGHQKGRNTKENIQRNFGMPTPHGYRKALRMMYYADHHGFPIVTFIDTPGAYADLKSEELGQGEAIAHNLRTMFGLKVPIISIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKASPKAAEKLKITGSELCKLQIADGVIPEPLGGAHADPSWTSQQIKIAINESMDELGKMDTQELLKHRNLKFRKIGGFQEGIPIDPKKKVNMKKKEGPIASKTSKEKLEDEVEKLKQQILKAKESSTKPPDAALNVMIQKLKKEVDHEFSEAAKAMGMQEKFATLRAEFSKGNSRDQLMDPILMDKITELKNEFNQGLASAPNYASLKYKLDMLKEFSNAKSLLDSKNKAAKLKQEINKKFEEVICRPDIKEKMEAIKAKLQDSGASSFSDLEDDLKEKLVETKKEIESELIDGLESLGLDVEVVKSKAKELSEQTSFSNFRSKMENLNEEINKKIEDVINSSDLKDMIELLKLEIAKAGKKPDVKSKCKIQALEQQIKQRLSEAVNSSELKEKHEELMAEISDATKSPGGLDGGVNNEHAKDDSSKYDESRVEINVGANRSFA

cccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHcHHHHcccccccccccccccccEEEccCEEEEEECcccccHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEccccHHHHHcccccccHHHHHHHcccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEcccccccc

*****GL*FSDQIVSLENKYQQALKDLYTHLTPIQRVNIARHPNRPTFLDHVFNITEKFVELHGDRAGYDDPAIVTGIGSMDGRTYMFMGHQKGRNTKENIQRNFGMPTPHGYRKALRMMYYADHHGFPIVTFIDTPGAYADLKSEELGQGEAIAHNLRTMFGLKVPIISIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKASPKAAEKLKITGSELCKLQIADGVIPEPLGGAHADPSWTSQQIKIAINESMDELGKMDTQELLKHRNLKFRKIGGFQE**************************************************************KEVDHEFSEAAKAMGMQEKFATL****************ILMDKITELKNEFNQGLASAPNYASLKYKLDMLK*************************FEEVICRPDIK*****************************VET**EIESELIDGLESLGLDVEV***********************************INSSDLKDMIELLKLEIA*******************QIK*******************************************************INVGAN****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MANDTGLDFSDQIVSLENKYQQALKDLYTHLTPIQRVNIARHPNRPTFLDHVFNITEKFVELHGDRAGYDDPAIVTGIGSMDGRTYMFMGHQKGRNTKENIQRNFGMPTPHGYRKALRMMYYADHHGFPIVTFIDTPGAYADLKSEELGQGEAIAHNLRTMFGLKVPIISIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKASPKAAEKLKITGSELCKLQIADGVIPEPLGGAHADPSWTSQQIKIAINESMDELGKMDTQELLKHRNLKFRKIGGFQEGIPIDPKKKVNMKKKEGPIASKTSxxxxxxxxxxxxxxxxxxxxxSTKPPDAALNVMIQKLKKEVDHEFSEAAKAMGMQEKFATLRAEFSKGNSRDQLMDPILMDKITELKNEFNQGLASAPNYASLKYKLDMLKEFSNAKSxxxxxxxxxxxxxxxxxxxxxVICRPDIKEKMEAIKAKLQDSGASSFSDLxxxxxxxxxxxxxxxxxxxxxGxxxxxxxxxxxxxxxxxxxxxTSxxxxxxxxxxxxxxxxxxxxxxxxxSDLKDMIELLKLEIAKAGKKPDVKSKCKIQALEQQIKQRLSEAVNxxxxxxxxxxxxxxxxxxxxxPGGLDGGVNNEHAKDDSSKYDESRVEINVGANRSFA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic	Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.	probable	Q9LD43

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
6.-.-.-	Ligases.	probable
6.4.-.-	Forming carbon-carbon bonds.	probable
6.4.1.-	Ligases that form carbon-carbon bonds.	probable
6.4.1.2	Acetyl-CoA carboxylase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F9I, chain A
Confidence level:very confident
Coverage over the Query: 9-293
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 353-435
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 346-410,421-430,443-505
View the alignment between query and template
View the model in PyMOL