Citrus Sinensis ID: 006157

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66

MSRQSSQAAAAQMNLLQQQRYLQLQQQHQQQQLLKAMPQQRPQLPQHFVQQQNLPLRSPAKPVYEPGMCARRLTHYMYQQQHRPEDNNIEFWRKFVAEYFAPNAKKKWCVSMYGSGRQATGVFPQDVWHCEICNRKPGRGFEATVEVLPRLFKIKYESGTLEELLYVDMPREYQNASGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSPDLKICSWEFCARRHEELIPRRLLIPQVSQLGAAAQKYQAATQNASSNLSAPELQNNCNMFVASARQLAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRVTGTGPMESLAKFPRRTSGASGFHSPSQQPEDQLQQQQQQQQTVGQNSNSESSVQANAMQLATSNGVANVNNSLNPASASSTASTIVGLLHQNSMNSRQQNTVNNASSPYGGSSVQMPSPGSSNNIPQAQPNPSPFQSPTPSSSNNPPQTSHSALTAANHMSSASSPANISVQQPALSGEADPRALSGDADPSDSQSAVQKILHEMMLCSHLNGGSGGGGGMVGVGSLGNDVKNVNDIMATGNNTVLNGGNGLVGNGTVNNNPGIGTGGYGNMGGGLGQSAMVNGIRAAMGNNSMMNGRVGMTAMARDQSMNHQQDLGNQLLNGLGAVNGFNNLQFDWKPSP

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccCEEEcccccccHHHHHcccccEEEEEEEccccCECcccccEEEEEccEEEEEEEccEEEEEEEEEEEEEcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcHHHHHHHHHHccccccHHHcccccccccccccccccccccHHHHHHHccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccc

***************************************************************YEPGMCARRLTHYMYQQQHRPEDNNIEFWRKFVAEYFAPNAKKKWCVSMYGSGRQATGVFPQDVWHCEICNRKPGRGFEATVEVLPRLFKIKYESGTLEELLYVDMPREYQNASGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSPDLKICSWEFCARRHEELIPRRLLIPQVS**************************************LAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRVT**************************************************************************************************************************************************************************************************************************************KNVNDIMATGNNTVLNGGNGLVGNGTVNNNPGIGTGGYGNMGGGLGQSAMVNGI*********************************QLLNGLGAVNGFNNLQFDW****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcriptional corepressor SEUSS	DNA-binding adapter subunit of the SEU-LUG transcriptional corepressor of the C class floral homeotic gene AGAMOUS during the early stages of floral meristem development. Is part of the A class cadastral complex that define the boundaries between the A and C class homeotic genes expression and function. Interacts together with APETALA2 and LEUNIG to repress AGAMOUS expression.	probable	Q8W234

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!