Citrus Sinensis ID: 006305

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-

MDRRSWLWRRKSGGGAAGGETESSGSVSSLSERFSDDQTHSSQSSEATSKAPPLDEVVNDSVKTLTEKLSAALLNVSAKEDLVKQHAKVAEEAVSGWEKAENELSTLKQQLKAASQKNSALENRVSHLDGALKECVRQLRQAREEQEQRIQETVSKQNLEWESKKSELESKLVDLQKKLQTAKSEAAASADRDLCSKLEAAEKQNSALKLELLSLVKELELRIVERDLSTKAAETASKQHLESIKKLAKVEAECLRLKAVVRKASPNTENKSFTPSSIYVGSFTDSQSDNGERLLGNETDNCKISDSEVNECEPNSSTSWASALAIEPDKNVKAVGRNVMVPSVDINLMDDFLEMERLAALPDTESRSFCVEVGPASDQPNADESSIKAELEVLIHRTAELEEELENMRAEKSELEMDLKESQRRLETSQNQLKEAELKLEELETQLAFANKSKQAVEVEMKAAIAARGVAESKLSVVEAEMKTQLALANKSKQAAEEEVKSAKSKKEAAESRLRAVEAEMETLRSKVISLEDEVEKERALSEENIANFQKSKDELSKVKQEIELQHEVKLQYLAGSNQELKINQEEELAVAASKFAECQKTIASLGRQLRSLVTLDDFLIDSEKPLEHTGEGKNGGESWNLQATEFTFVA

ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHccccHHHHHHHHHHccccccHHHccccHcccccccccccHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccc

*DRRSWLW***************************************************************ALLN************************************************************************************************************************************LKLELLSLVKELELRIVER*******************KLAKVEAECLRLKAVV**************************************************************LAI***KNVKAVGRNVMVPSVDINLMDDFLEMERLAAL**************************************************************************************************************************************************************************************************************EVKLQYLAG******I***EELAVAASKFAECQKTIASLGRQLRSLVTLDDFLID********************QA**FTF**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDRRSWLWRRKSGGGAAGGETESSGSVSSLSERFSDDQTHSSQSSEATSKAPPLDEVVNDSVKTLTEKLSAALLNVSAKEDLVKQHAKVAEEAVSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLCSKxxxxxxxxxxxxxxxxxxxxxLELRIVERDLSTKAAETASKQHLESIKKLAKVEAECLRLKAVVRKASPNTENKSFTPSSIYVGSFTDSQSDNGERLLGNETDNCKISDSEVNECEPNSSTSWASALAIEPDKNVKAVGRNVMVPSVDINLMDDFLEMERLAALPDTESRSFCVEVGPASDQPNADESSIKAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMKAAIAARGVAESKLSVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHEVKLQYLAGSNQELKINQEEELAVAASKFAECQKTIASLGRQLRSLVTLDDFLIDSEKPLEHTGEGKNGGESWNLQATEFTFVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Filament-like plant protein 3		probable	Q9MA92

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 386-420
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 509-533
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 387-459,470-493,504-530
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 58-72,91-220
View the alignment between query and template
View the model in PyMOL

Template: 1GO4, chain E
Confidence level:probable
Coverage over the Query: 192-265
View the alignment between query and template
View the model in PyMOL

Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 362-569
View the alignment between query and template
View the model in PyMOL