Citrus Sinensis ID: 006356

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------65
MKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVTWVEHAEYDESQVHQLYKPLIISGMGFGAQRWVATLQRQCECLAILMSTSVSARDHTAITAGGRRSMLKLAQRMTDNFCAGVCASTVHKWNKLNAGNVDEDVRVMTRKSVDDPGEPPGIVLSAATSVWLPVSPQRLFNFLRDERLRSEWDILSNGGPMQEMAHIAKGQDHGNCVSLLRASAINANQSSMLILQETCTDAAGSLVVYAPVDIPAMHVVMNGGDSAYVALLPSGFAIVPDGPDSRGPLANGPTSGNGSNGGSQRVGGSLLTVAFQILVNSLPTAKLTVESVETVNNLISCTVQKIKAALQCES
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEECcccccccEEEcHHHHHHccccccccccccccEEEEEEEEEEEEcHHHHHHHHcccHHHHHccccccccccccEEECccccccccccEEEEHHHHHccccccccEEEEEEEEEEEcccccEEEEEEEcccccccccccccccCECcccccEEEEcccccEEEEEEEcccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccccCEEEEEEEEccccccHHHHHHHHHcccccccHHHcccccccEEEEEcccccccccEEEEEEEccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
*******HENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLG*****************LGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVM**********GLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIR**SGAPAFVNCRRLPSGCVVQDMPNGYSKVTWVEHAEYDESQVHQLYKPLIISGMGFGAQRWVATLQRQCECLAILMSTSVSARDHTAITAGGRRSMLKLAQRMTDNFCAGVCASTVHKWNKLNAGNVDEDVRVMTRK******EPPGIVLSAATSVWLPVSPQRLFNFLRDERLRSEWDILSNGGPMQEMAHIAKGQDHGNCVSLLRASAINANQSSMLILQETCTDAAGSLVVYAPVDIPAMHVVMNGGDSAYVALLPSGFAIVPD*************************GGSLLTVAFQILVNSLPTAKLTVESVETVNNLISCTVQKIKAALQC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTQxxxxxxxxxxxxxxxxxxxxxxxxxxMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVTWVEHAEYDESQVHQLYKPLIISGMGFGAQRWVATLQRQCECLAILMSTSVSARDHTAITAGGRRSMLKLAQRMTDNFCAGVCASTVHKWNKLNAGNVDEDVRVMTRKSVDDPGEPPGIVLSAATSVWLPVSPQRLFNFLRDERLRSEWDILSNGGPMQEMAHIAKGQDHGNCVSLLRASAINANQSSMLILQETCTDAAGSLVVYAPVDIPAMHVVMNGGDSAYVALLPSGFAIVPDGPDSRGPLANGPTSGNGSNGGSQRVGGSLLTVAFQILVNSLPTAKLTVESVETVNNLISCTVQKIKAALQCES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox-leucine zipper protein ANTHOCYANINLESS 2 Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root.probableQ0WV12
Homeobox-leucine zipper protein ROC5 Probable transcription factor.probableQ6EPF0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R55, chain A
Confidence level:confident
Coverage over the Query: 150-380
View the alignment between query and template
View the model in PyMOL
Template: 2R55, chain A
Confidence level:probable
Coverage over the Query: 400-576,600-645
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 11-34,49-76
View the alignment between query and template
View the model in PyMOL