Citrus Sinensis ID: 006387


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPVC
cccccccccccEEEcccEEccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccEEcEEEEcccHHHHHHHHHccccccEEEEccccccccccccccccEEECccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEcccEEEEEEccccccccEEEEEEEEEccccEEEEEEEcEEEECcccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHcHHHHHHHHHccccccccccccccccccccccEEccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEEEccccccccccccccccccc
********TSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPV*ENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGxxxxxxxxxxxxxxxxxxxxxWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPVC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
L-aspartate oxidase 1 Catalyzes the oxidation of L-aspartate to iminoaspartate.probableQ8XWM7
L-aspartate oxidase Catalyzes the oxidation of L-aspartate to iminoaspartate.probableQ8ZMX9
L-aspartate oxidase Catalyzes the oxidation of L-aspartate to iminoaspartate.probableQ51363

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.4.-.-Acting on the CH-NH(2) group of donors.probable
1.4.3.-With oxygen as acceptor.probable
1.4.3.16L-aspartate oxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CHU, chain A
Confidence level:very confident
Coverage over the Query: 86-123,137-183,218-628
View the alignment between query and template
View the model in PyMOL
Template: 3GYX, chain A
Confidence level:very confident
Coverage over the Query: 86-644
View the alignment between query and template
View the model in PyMOL