Citrus Sinensis ID: 006387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPVC
cccccccccccEEEcccEEccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccEEcEEEEcccHHHHHHHHHccccccEEEEccccccccccccccccEEEEccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEcccEEEEEEccccccccEEEEEEEEEccccEEEEEEEcEEEEEccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHcHHHHHHHHHccccccccccccccccccccccEEccccccccccccEEEccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccccccccccccccc
cccEEEcccccEEEEEEEEcccccHcccccccccccccccccccccccHHHHEEEEEcccccccHHcccccccccccccccccccccEEcEEEEcccHHHHHHHHHHHccccEEEEccccccccHHHHccccEEccccccccHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHcccccccccccccEcEEcccccccccEEcccccHHHHHHHHHHHHHHccccEEEEccEEEEEEEEHccccccEEEEEEEEEcccccEEEEEccEEEEcccccHHHcccEccccccccHHHHHHHHccccEEccccEEEEEEEEcccccccccccccHcccEccHHHHHcccEEEcccccEcHHHccccHHHccHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHcHHHHHHHHccccccccccEEEEEEEEEEccEEEcccccEcccEcEEEccccEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEccEcEccEcccccHHHcHcEEEcccccEEEEcEcccccccc
matgvaartsnfhfggirckgqscqQASLVSSLTFNGCIQRELSWSFGVSRFLrfqrfnfshspvsenwkslrtvpvlsclrdgsvkyfdfsvigsGVAGLCYALEVAkhgtvavitkaephesntnyaqggvsavlcpsdsveshmQDTIVAGaylcddetvRVVCTEGPDRIRELIAIGasfdrgedgnlhlaregghshhRIVHAADMTGREIERALLEAvvsdpnisvfeHHFAIDLlttldgpdavchgvdtLNVETQEVVRFISKVTLLasggaghiypsttnplvatgdgMAMAHRAQAVIsnmefvqfhptaladeglpikpkktrenSFLITEavrgdggilynlgmerfmplyderaelaprdvVARSIDDQLKKRNEKYVLLdishkptekilshFPNIAAECLKYglditsqpipvvpaahymcggvraglqgetnvrGLYVAGEVactglhganrlASNSLLEALVFARRavqpsidhkkstsidlsasnwwtrtvvpkslgcnvmHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALarhesrglhymvdfphveenkrlptiilpslvnctwssrqlhklpvc
matgvaartsnfhfggirckGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNfshspvsenwkslrtVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTaladeglpikpkktrensfliteavrgdggilYNLGMERFMPLYDERAELAPRDVVARsiddqlkkrneKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAvqpsidhkkstsidlsasnwwtrtvvpkslgcnvmhnILRRTKEVRKELQSIMWRyvgivrsttslqtAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPslvnctwssrqlhklpvc
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPVC
*********SNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAE*****TNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIK****RENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSR********
********TSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQ****************************SVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKK**********************CNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPV*
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSR********
*ATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPV*ENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHK***C
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNFSHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGxxxxxxxxxxxxxxxxxxxxxWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSLVNCTWSSRQLHKLPVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query647 2.2.26 [Sep-21-2011]
Q8XWM7533 L-aspartate oxidase 1 OS= yes no 0.802 0.973 0.470 1e-125
Q51363538 L-aspartate oxidase OS=Ps yes no 0.802 0.964 0.448 1e-120
Q9KPA4535 L-aspartate oxidase OS=Vi yes no 0.795 0.962 0.446 1e-118
Q8ZD80533 L-aspartate oxidase OS=Ye yes no 0.797 0.968 0.430 1e-113
Q8ZMX9540 L-aspartate oxidase OS=Sa yes no 0.809 0.970 0.426 1e-111
P10902540 L-aspartate oxidase OS=Es N/A no 0.808 0.968 0.422 1e-110
Q8Z4K0540 L-aspartate oxidase OS=Sa N/A no 0.808 0.968 0.426 1e-110
Q8XA23540 L-aspartate oxidase OS=Es N/A no 0.794 0.951 0.427 1e-109
Q8XQG4536 L-aspartate oxidase 2 OS= no no 0.786 0.949 0.403 8e-99
Q9K107502 L-aspartate oxidase OS=Ne yes no 0.765 0.986 0.411 3e-96
>sp|Q8XWM7|NADB1_RALSO L-aspartate oxidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB1 PE=3 SV=1 Back     alignment and function desciption
 Score =  449 bits (1154), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 257/546 (47%), Positives = 324/546 (59%), Gaps = 27/546 (4%)

Query: 89  FDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQ 148
           FD +V+GSG+AGL  AL +A H  V VI+K    E  +++AQGG++AVL  +DS + H+ 
Sbjct: 3   FDVAVVGSGLAGLTVALHLADHRRVVVISKRTLPEGASDWAQGGIAAVLDSNDSHDEHVD 62

Query: 149 DTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGEDGNL--HLAREGGHSHHRIV 206
           DT++AGA LCD+   R +   G   I  LI  G  F R     L  HL REGGH H RI+
Sbjct: 63  DTLIAGAGLCDEAATRYIVENGRAAIEWLIGHGVPFTRDARAELGFHLTREGGHRHRRII 122

Query: 207 HAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLT--TLDGPDAVCHGVDTLNVETQE 264
           HAAD TG  +   L++ V + PNI++ E HFAIDL+T   L  P   CHG+  L+ +  +
Sbjct: 123 HAADATGHAVVTTLVDKVRAHPNITLLEDHFAIDLVTDAKLGLPGMRCHGLYVLDCKRGD 182

Query: 265 VVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADE 324
           V   I+  T+LA+GGAG +Y  TTNP  ATGDG+AMA RA   ++NMEF+QFHPT L   
Sbjct: 183 VKTIIASQTVLATGGAGKVYLYTTNPDTATGDGIAMAWRAGCRVANMEFIQFHPTCL--- 239

Query: 325 GLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLK 384
                       SFLI+EAVRG+GG L      RFMP +DERAELAPRD+VAR+ID ++K
Sbjct: 240 ------YHPFAKSFLISEAVRGEGGKLVLPDGTRFMPAHDERAELAPRDIVARAIDFEMK 293

Query: 385 KRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQ 444
           KR    V LDISH+    I  HFP I A CL+ G+DIT QPIPVVPAAHY CGGV     
Sbjct: 294 KRGLDCVYLDISHQSPAFIQEHFPTILARCLELGIDITRQPIPVVPAAHYTCGGVVTDQL 353

Query: 445 GETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNW 504
           G T++ GLY  GE A TGLHGANRLASNSLLE +V  R A Q  +    +         W
Sbjct: 354 GRTDIAGLYAVGETAYTGLHGANRLASNSLLECMVIGRGAAQDILGQPATAPTPTPIPAW 413

Query: 505 WTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEW 564
               V        V HN          EL+ +MW YVGIVR+   L+ A+ RI  L  E 
Sbjct: 414 DESRVTDADEEVVVSHNW--------DELRRMMWNYVGIVRTNKRLERAQHRIALLREEI 465

Query: 565 ETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLP 624
             Y     +    V  +  E+RNL   A L+V SAL+RHESRGLH+  D+P     K LP
Sbjct: 466 AEY-----YANFRVSHDLLELRNLVEAASLIVDSALSRHESRGLHFSRDYPQTLP-KALP 519

Query: 625 TIILPS 630
           T++ P+
Sbjct: 520 TVMQPA 525
Catalyzes the oxidation of L-aspartate to iminoaspartate.
Ralstonia solanacearum (strain GMI1000) (taxid: 267608)
EC: 1EC: .EC: 4EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q51363|NADB_PSEAE L-aspartate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadB PE=3 SV=1 Back     alignment and function description
>sp|Q9KPA4|NADB_VIBCH L-aspartate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nadB PE=3 SV=2 Back     alignment and function description
>sp|Q8ZD80|NADB_YERPE L-aspartate oxidase OS=Yersinia pestis GN=nadB PE=3 SV=2 Back     alignment and function description
>sp|Q8ZMX9|NADB_SALTY L-aspartate oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadB PE=3 SV=1 Back     alignment and function description
>sp|P10902|NADB_ECOLI L-aspartate oxidase OS=Escherichia coli (strain K12) GN=nadB PE=1 SV=4 Back     alignment and function description
>sp|Q8Z4K0|NADB_SALTI L-aspartate oxidase OS=Salmonella typhi GN=nadB PE=3 SV=1 Back     alignment and function description
>sp|Q8XA23|NADB_ECO57 L-aspartate oxidase OS=Escherichia coli O157:H7 GN=nadB PE=3 SV=1 Back     alignment and function description
>sp|Q8XQG4|NADB2_RALSO L-aspartate oxidase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB2 PE=3 SV=1 Back     alignment and function description
>sp|Q9K107|NADB_NEIMB L-aspartate oxidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nadB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query647
225452458647 PREDICTED: L-aspartate oxidase 1-like [V 0.992 0.992 0.829 0.0
255552562655 l-aspartate oxidase, putative [Ricinus c 0.992 0.980 0.802 0.0
224055531601 predicted protein [Populus trichocarpa] 0.924 0.995 0.873 0.0
449483753646 PREDICTED: L-aspartate oxidase-like [Cuc 0.996 0.998 0.769 0.0
356511664647 PREDICTED: L-aspartate oxidase 1-like [G 0.995 0.995 0.757 0.0
449450109646 PREDICTED: L-aspartate oxidase-like [Cuc 0.996 0.998 0.768 0.0
18417469651 L-aspartate oxidase [Arabidopsis thalian 0.967 0.961 0.776 0.0
357496009645 L-aspartate oxidase [Medicago truncatula 0.990 0.993 0.742 0.0
297807493641 L-aspartate oxidase [Arabidopsis lyrata 0.964 0.973 0.761 0.0
270342121667 L-aspartate oxidase [Phaseolus vulgaris] 0.989 0.959 0.740 0.0
>gi|225452458|ref|XP_002274361.1| PREDICTED: L-aspartate oxidase 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/644 (82%), Positives = 576/644 (89%), Gaps = 2/644 (0%)

Query: 1   MATGVAARTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFNF 60
           M T VAA +S  HF    C+GQSC QAS VS +TF GC Q+ LS S  VS+ L+ QR NF
Sbjct: 1   MTTAVAAGSSKLHFRETVCRGQSCGQASWVSGVTFKGCPQKGLSGSSWVSKVLQIQRRNF 60

Query: 61  SHSPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAE 120
             S +++NWK LR V   S L+DGSVKYFDF+VIGSGVAGL YALEVAKHG+VAVITKAE
Sbjct: 61  RQSSINDNWKPLRAVSA-SYLKDGSVKYFDFAVIGSGVAGLRYALEVAKHGSVAVITKAE 119

Query: 121 PHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAI 180
           PHESNTNYAQGGVSAVLCP DSVESHM+DTI+AGAYLCD+ETVRVVCTEGPDRIRELIA+
Sbjct: 120 PHESNTNYAQGGVSAVLCPLDSVESHMRDTIIAGAYLCDEETVRVVCTEGPDRIRELIAM 179

Query: 181 GASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAID 240
           GASFD GEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVV+DPNI +FEHHFAID
Sbjct: 180 GASFDHGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVNDPNIFMFEHHFAID 239

Query: 241 LLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAM 300
           LLT+ DG D VCHGVDTLN ETQEVVRFI+KV LLASGGAGHIYP+TTNPLVATGDG+AM
Sbjct: 240 LLTSQDGSDTVCHGVDTLNTETQEVVRFIAKVILLASGGAGHIYPTTTNPLVATGDGIAM 299

Query: 301 AHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFM 360
           AHRAQAVISNMEFVQFHPTALADEGLPI P KTREN+FLITEAVRGDGGILYNL MERFM
Sbjct: 300 AHRAQAVISNMEFVQFHPTALADEGLPITPAKTRENAFLITEAVRGDGGILYNLSMERFM 359

Query: 361 PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLD 420
           PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKP EKILSHFPNIAAECLKYGLD
Sbjct: 360 PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPKEKILSHFPNIAAECLKYGLD 419

Query: 421 ITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVF 480
           IT QPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVF
Sbjct: 420 ITRQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVF 479

Query: 481 ARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRY 540
           ARRAVQPSIDH  ++++DLSASNWW   VVP SLG N+M+++L  T++VRKELQSIMW+Y
Sbjct: 480 ARRAVQPSIDHMSNSTLDLSASNWWAEPVVPTSLGSNIMNDVLSGTRKVRKELQSIMWKY 539

Query: 541 VGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSAL 600
           VGIVRST  L+TAE RI ELEA+WE YLF+ GWE T VGLEACEMRNLFCCAKLVVSSAL
Sbjct: 540 VGIVRSTRRLKTAEQRIAELEAKWEQYLFQQGWEPTMVGLEACEMRNLFCCAKLVVSSAL 599

Query: 601 ARHESRGLHYMVDFPHVEENKRLPTIILP-SLVNCTWSSRQLHK 643
           ARHESRGLHY +DFPH+ E+KRLPT+I P S +N TWSSRQLH 
Sbjct: 600 ARHESRGLHYTIDFPHLVESKRLPTVIFPCSPMNGTWSSRQLHN 643

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255552562|ref|XP_002517324.1| l-aspartate oxidase, putative [Ricinus communis] gi|223543335|gb|EEF44866.1| l-aspartate oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224055531|ref|XP_002298525.1| predicted protein [Populus trichocarpa] gi|222845783|gb|EEE83330.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449483753|ref|XP_004156680.1| PREDICTED: L-aspartate oxidase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511664|ref|XP_003524543.1| PREDICTED: L-aspartate oxidase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449450109|ref|XP_004142806.1| PREDICTED: L-aspartate oxidase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18417469|ref|NP_568304.1| L-aspartate oxidase [Arabidopsis thaliana] gi|15010650|gb|AAK73984.1| AT5g14760/T9L3_60 [Arabidopsis thaliana] gi|24111279|gb|AAN46763.1| At5g14760/T9L3_60 [Arabidopsis thaliana] gi|332004691|gb|AED92074.1| L-aspartate oxidase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357496009|ref|XP_003618293.1| L-aspartate oxidase [Medicago truncatula] gi|355493308|gb|AES74511.1| L-aspartate oxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297807493|ref|XP_002871630.1| L-aspartate oxidase [Arabidopsis lyrata subsp. lyrata] gi|297317467|gb|EFH47889.1| L-aspartate oxidase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|270342121|gb|ACZ74704.1| L-aspartate oxidase [Phaseolus vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query647
TAIR|locus:2185480651 AO "L-aspartate oxidase" [Arab 0.982 0.976 0.769 1.7e-258
TIGR_CMR|GSU_1827531 GSU_1827 "L-aspartate oxidase" 0.783 0.954 0.483 5.1e-122
UNIPROTKB|Q9KPA4535 nadB "L-aspartate oxidase" [Vi 0.794 0.960 0.450 3e-108
TIGR_CMR|VC_2469535 VC_2469 "L-aspartate oxidase" 0.794 0.960 0.450 3e-108
TIGR_CMR|CPS_4130532 CPS_4130 "L-aspartate oxidase" 0.797 0.969 0.443 6.3e-108
TIGR_CMR|SO_1341537 SO_1341 "L-aspartate oxidase" 0.799 0.962 0.444 1.2e-106
TIGR_CMR|CBU_0101536 CBU_0101 "L-aspartate oxidase" 0.782 0.944 0.453 5.3e-104
UNIPROTKB|P10902540 nadB [Escherichia coli K-12 (t 0.791 0.948 0.436 3.7e-103
TIGR_CMR|CHY_2373519 CHY_2373 "L-aspartate oxidase" 0.434 0.541 0.501 2e-71
TIGR_CMR|SPO_3244516 SPO_3244 "L-aspartate oxidase, 0.610 0.765 0.398 6.8e-71
TAIR|locus:2185480 AO "L-aspartate oxidase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2488 (880.9 bits), Expect = 1.7e-258, P = 1.7e-258
 Identities = 501/651 (76%), Positives = 552/651 (84%)

Query:     1 MATGVAA-RTSNFHFGGIRCKGQSCQQASLVSSLTFNGCIQRELSWSFGVSRFLRFQRFN 59
             MA  V+     NF+  G   +GQ+    S  S+ TF     +E SWS GV + L+ +R  
Sbjct:     1 MAAHVSTGNIHNFYLAGQVYRGQAF---SWSSASTFMANPFKEPSWSSGVFKALKAERCG 57

Query:    60 -FSH--SPVSENWKSLRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVI 116
              +S   SP+SE  K +R V V S     S KY+DF+VIGSGVAGL YALEVAK GTVAVI
Sbjct:    58 CYSRGISPISETSKPIRAVSVSS-----STKYYDFTVIGSGVAGLRYALEVAKQGTVAVI 112

Query:   117 TKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRE 176
             TK EPHESNTNYAQGGVSAVLCP DSVESHM+DT+VAGA+LCD+ETVRVVCTEGP+RIRE
Sbjct:   113 TKDEPHESNTNYAQGGVSAVLCPLDSVESHMRDTMVAGAHLCDEETVRVVCTEGPERIRE 172

Query:   177 LIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHH 236
             LIA+GASFD GEDGNLHLAREGGHSH RIVHAADMTGREIERALLEAV++DPNISVF+HH
Sbjct:   173 LIAMGASFDHGEDGNLHLAREGGHSHCRIVHAADMTGREIERALLEAVLNDPNISVFKHH 232

Query:   237 FAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGD 296
             FAIDLLT+ DG + VCHGVDTLN++T EVVRFISKVTLLASGGAGHIYPSTTNPLVATGD
Sbjct:   233 FAIDLLTSQDGLNTVCHGVDTLNIKTNEVVRFISKVTLLASGGAGHIYPSTTNPLVATGD 292

Query:   297 GMAMAHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGM 356
             GMAMAHRAQAVISNMEFVQFHPTALADEGLPIK +  REN+FLITEAVRGDGGILYNLGM
Sbjct:   293 GMAMAHRAQAVISNMEFVQFHPTALADEGLPIKLQTARENAFLITEAVRGDGGILYNLGM 352

Query:   357 ERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLK 416
             ERFMP+YDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKP EKIL+HFPNIA+ECLK
Sbjct:   353 ERFMPVYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPREKILAHFPNIASECLK 412

Query:   417 YGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLE 476
             +GLDIT QPIPVVPAAHYMCGGVRAGLQGETNV GL+VAGEVACTGLHGANRLASNSLLE
Sbjct:   413 HGLDITRQPIPVVPAAHYMCGGVRAGLQGETNVLGLFVAGEVACTGLHGANRLASNSLLE 472

Query:   477 ALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKS--LGCNVMHNILRRTKEVRKELQ 534
             ALVFARRAVQPS +  K T +D+ AS  WTR VV  +  LG  V+  I+  TKEVR+ELQ
Sbjct:   473 ALVFARRAVQPSTELMKRTRLDVCASEKWTRPVVATARLLGDEVIAKIIALTKEVRRELQ 532

Query:   535 SIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKL 594
              +MW+YVGIVRST  L TAE +I ELEA+WET+LFEHGWEQT V LEACEMRNLFCCAKL
Sbjct:   533 EVMWKYVGIVRSTIRLTTAERKIAELEAKWETFLFEHGWEQTVVALEACEMRNLFCCAKL 592

Query:   595 VVSSALARHESRGLHYMVDFPHVEENKRLPTIILPSL-VNCTWSSRQLHKL 644
             VVSSALARHESRGLHYM DFP VEE+KR+PTIILPS     +WSSR+L  +
Sbjct:   593 VVSSALARHESRGLHYMTDFPFVEESKRIPTIILPSSPTTASWSSRRLQNI 643
GO:0005737 "cytoplasm" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008734 "L-aspartate oxidase activity" evidence=IEA;ISS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009435 "NAD biosynthetic process" evidence=IEA;IGI;ISS;IMP
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
TIGR_CMR|GSU_1827 GSU_1827 "L-aspartate oxidase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPA4 nadB "L-aspartate oxidase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2469 VC_2469 "L-aspartate oxidase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4130 CPS_4130 "L-aspartate oxidase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1341 SO_1341 "L-aspartate oxidase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0101 CBU_0101 "L-aspartate oxidase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P10902 nadB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2373 CHY_2373 "L-aspartate oxidase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3244 SPO_3244 "L-aspartate oxidase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8XWM7NADB1_RALSO1, ., 4, ., 3, ., 1, 60.47060.80210.9737yesno
Q51363NADB_PSEAE1, ., 4, ., 3, ., 1, 60.44820.80210.9646yesno
Q8ZMX9NADB_SALTY1, ., 4, ., 3, ., 1, 60.42680.80980.9703yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3.160.914
3rd Layer1.4.30.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.I.2445.1
L-aspartate oxidase (601 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_VIII0550
nicotinate-nucleotide diphosphorylase (carboxylating) (EC-2.4.2.19) (329 aa)
••••  • 0.969
estExt_fgenesh4_pg.C_LG_XVI0748
adenylosuccinate synthase (EC-6.3.4.4); Plays an important role in the de novo pathway of purin [...] (491 aa)
     •• 0.949
fgenesh4_pg.C_LG_XV000597
quinolinate synthetase A (724 aa)
     •• 0.913
eugene3.00012554
aspartate carbamoyltransferase (EC-2.1.3.2) (332 aa)
     •• 0.904
gw1.X.6595.1
annotation not avaliable (296 aa)
•••   • 0.900
gw1.X.3427.1
hypothetical protein (424 aa)
     •  0.899
gw1.V.2829.1
SubName- Full=Putative uncharacterized protein; (566 aa)
     •  0.899
grail3.0090013702
argininosuccinate synthase family protein (EC-6.3.4.5) (470 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_I0800
asparagine synthase (glutamine-hydrolyzing) (EC-6.3.5.4) (588 aa)
     •  0.899
estExt_fgenesh4_pg.C_LG_VI1497
hypothetical protein (370 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
PLN02815594 PLN02815, PLN02815, L-aspartate oxidase 0.0
COG0029518 COG0029, NadB, Aspartate oxidase [Coenzyme metabol 0.0
PRK09077536 PRK09077, PRK09077, L-aspartate oxidase; Provision 0.0
TIGR00551488 TIGR00551, nadB, L-aspartate oxidase 1e-171
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provision 1e-169
PRK07395553 PRK07395, PRK07395, L-aspartate oxidase; Provision 1e-163
PRK08071510 PRK08071, PRK08071, L-aspartate oxidase; Provision 1e-150
PRK07512513 PRK07512, PRK07512, L-aspartate oxidase; Provision 1e-143
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 1e-134
PRK06263543 PRK06263, sdhA, succinate dehydrogenase flavoprote 1e-133
TIGR01812541 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase 1e-132
PRK06175433 PRK06175, PRK06175, L-aspartate oxidase; Provision 1e-124
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprote 1e-115
PRK08205583 PRK08205, sdhA, succinate dehydrogenase flavoprote 1e-111
TIGR01816565 TIGR01816, sdhA_forward, succinate dehydrogenase, 1e-110
PRK07057591 PRK07057, sdhA, succinate dehydrogenase flavoprote 1e-100
PTZ00139617 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiqu 4e-97
PRK06452566 PRK06452, sdhA, succinate dehydrogenase flavoprote 8e-95
PRK05945575 PRK05945, sdhA, succinate dehydrogenase flavoprote 1e-94
PRK09231582 PRK09231, PRK09231, fumarate reductase flavoprotei 6e-91
TIGR01176580 TIGR01176, fum_red_Fp, fumarate reductase, flavopr 1e-90
PRK05675570 PRK05675, sdhA, succinate dehydrogenase flavoprote 1e-90
PRK08958588 PRK08958, sdhA, succinate dehydrogenase flavoprote 4e-87
PLN00128635 PLN00128, PLN00128, Succinate dehydrogenase [ubiqu 2e-86
PRK09078598 PRK09078, sdhA, succinate dehydrogenase flavoprote 1e-85
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 3e-85
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprote 8e-85
PRK08401466 PRK08401, PRK08401, L-aspartate oxidase; Provision 5e-73
PRK08626657 PRK08626, PRK08626, fumarate reductase flavoprotei 7e-73
TIGR01811603 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fu 9e-59
PRK08641589 PRK08641, sdhA, succinate dehydrogenase flavoprote 1e-55
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 1e-39
PRK07573640 PRK07573, sdhA, succinate dehydrogenase flavoprote 1e-26
PRK06481506 PRK06481, PRK06481, fumarate reductase flavoprotei 2e-26
pfam02910127 pfam02910, Succ_DH_flav_C, Fumarate reductase flav 1e-21
PTZ00306 1167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 1e-18
PRK13800 897 PRK13800, PRK13800, putative oxidoreductase/HEAT r 1e-08
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provi 1e-08
PTZ00306 1167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 5e-07
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provi 4e-05
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subu 7e-05
PRK08274466 PRK08274, PRK08274, tricarballylate dehydrogenase; 6e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 0.001
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subu 0.003
>gnl|CDD|215436 PLN02815, PLN02815, L-aspartate oxidase Back     alignment and domain information 
 Score = 1143 bits (2959), Expect = 0.0
 Identities = 460/588 (78%), Positives = 499/588 (84%), Gaps = 3/588 (0%)

Query: 63  SPVSENWKSLRT--VPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAE 120
           S ++   K +        S L D S KYFDF VIGSG+AGL YALEVA++GTVA+ITK E
Sbjct: 2   SAIAATRKPIGAERASSASRLDDESTKYFDFLVIGSGIAGLRYALEVAEYGTVAIITKDE 61

Query: 121 PHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAI 180
           PHESNTNYAQGGVSAVL PSDSVESHM+DTIVAGA+LCD+ETVRVVCTEGP+R++ELIA+
Sbjct: 62  PHESNTNYAQGGVSAVLDPSDSVESHMRDTIVAGAFLCDEETVRVVCTEGPERVKELIAM 121

Query: 181 GASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAID 240
           GASFD GEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAV +DPNI+ FEHHFAID
Sbjct: 122 GASFDHGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVKNDPNITFFEHHFAID 181

Query: 241 LLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAM 300
           LLT+ DG   VCHG D L+  T EVVRFISKVTLLASGGAGHIYPSTTNPLVATGDG+AM
Sbjct: 182 LLTSQDGGSIVCHGADVLDTRTGEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGIAM 241

Query: 301 AHRAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFM 360
           AHRAQAV+SNMEFVQFHPTALADEGLPIKP K REN+FLITEAVRGDGGILYNL  ERFM
Sbjct: 242 AHRAQAVVSNMEFVQFHPTALADEGLPIKPAKARENAFLITEAVRGDGGILYNLAGERFM 301

Query: 361 PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLD 420
           PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKP E+ILSHFPNIAAECLK GLD
Sbjct: 302 PLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPREEILSHFPNIAAECLKRGLD 361

Query: 421 ITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVF 480
           IT QPIPVVPAAHYMCGGVR GLQGETNV+GLY AGEVACTGLHGANRLASNSLLEALVF
Sbjct: 362 ITKQPIPVVPAAHYMCGGVRTGLQGETNVQGLYAAGEVACTGLHGANRLASNSLLEALVF 421

Query: 481 ARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRY 540
           ARRAVQPSIDH      D+SA+  W R V P +L  +VM  IL  T  VRKELQ IMW Y
Sbjct: 422 ARRAVQPSIDHMARALRDVSAAAAWARPVAPTALADSVMDEILEWTAVVRKELQRIMWNY 481

Query: 541 VGIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSAL 600
           VGIVRST  L+TAE +++ELEAEWE  LF HGW+ T VGLEACEMRNLFC AKLVVSSAL
Sbjct: 482 VGIVRSTERLETAERKLEELEAEWEAILFRHGWKPTMVGLEACEMRNLFCVAKLVVSSAL 541

Query: 601 ARHESRGLHYMVDFPHVEENKRLPTIILPSLV-NCTWSSRQLHKLPVC 647
           AR ESRGLHY  D+P + E++R PT+I PS+    TWSSR LH+    
Sbjct: 542 ARKESRGLHYTTDYPELVESERKPTVIFPSVPTAGTWSSRSLHRPKRG 589

Length = 594
>gnl|CDD|223108 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236374 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233018 TIGR00551, nadB, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236010 PRK07395, PRK07395, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236147 PRK08071, PRK08071, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236036 PRK07512, PRK07512, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235758 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233582 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|180442 PRK06175, PRK06175, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236185 PRK08205, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|240286 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|180567 PRK06452, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180319 PRK05945, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236421 PRK09231, PRK09231, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|233302 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit Back     alignment and domain information
>gnl|CDD|180193 PRK05675, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181594 PRK08958, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|177739 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>gnl|CDD|236375 PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|236101 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236259 PRK08401, PRK08401, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181507 PRK08626, PRK08626, fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|130870 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>gnl|CDD|236319 PRK08641, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233583 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|236054 PRK07573, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|217281 pfam02910, Succ_DH_flav_C, Fumarate reductase flavoprotein C-term Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|237512 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235879 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|235879 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 647
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 100.0
PLN02815594 L-aspartate oxidase 100.0
PRK07395553 L-aspartate oxidase; Provisional 100.0
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 100.0
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08626657 fumarate reductase flavoprotein subunit; Provision 100.0
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
PRK09231582 fumarate reductase flavoprotein subunit; Validated 100.0
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK09077536 L-aspartate oxidase; Provisional 100.0
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 100.0
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07804541 L-aspartate oxidase; Provisional 100.0
PRK07512513 L-aspartate oxidase; Provisional 100.0
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 100.0
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08071510 L-aspartate oxidase; Provisional 100.0
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 100.0
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 100.0
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 100.0
PRK08401466 L-aspartate oxidase; Provisional 100.0
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 100.0
PRK08275554 putative oxidoreductase; Provisional 100.0
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 100.0
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 100.0
KOG2403642 consensus Succinate dehydrogenase, flavoprotein su 100.0
PRK06175433 L-aspartate oxidase; Provisional 100.0
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 100.0
PRK06481506 fumarate reductase flavoprotein subunit; Validated 100.0
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 100.0
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 100.0
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 100.0
PRK07121492 hypothetical protein; Validated 100.0
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 100.0
PRK08274466 tricarballylate dehydrogenase; Validated 100.0
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 100.0
PRK12839572 hypothetical protein; Provisional 100.0
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12842574 putative succinate dehydrogenase; Reviewed 100.0
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 100.0
COG2081408 Predicted flavoproteins [General function predicti 99.96
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.93
COG3573552 Predicted oxidoreductase [General function predict 99.92
PF02910129 Succ_DH_flav_C: Fumarate reductase flavoprotein C- 99.91
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.89
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.81
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.71
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.69
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.69
PLN02546558 glutathione reductase 99.69
PTZ00058561 glutathione reductase; Provisional 99.68
PLN02507499 glutathione reductase 99.68
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.68
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.65
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.65
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.65
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.64
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.64
PLN02661357 Putative thiazole synthesis 99.63
PRK06116450 glutathione reductase; Validated 99.63
PRK06370463 mercuric reductase; Validated 99.6
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.59
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.58
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.58
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.58
PRK14694468 putative mercuric reductase; Provisional 99.57
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.57
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.57
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.57
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.57
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.55
PTZ00153659 lipoamide dehydrogenase; Provisional 99.53
PRK13748561 putative mercuric reductase; Provisional 99.53
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.52
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.52
PRK14727479 putative mercuric reductase; Provisional 99.52
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.52
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.51
TIGR02053463 MerA mercuric reductase. This model represents the 99.51
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.51
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.51
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.5
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.5
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.5
PRK07846451 mycothione reductase; Reviewed 99.5
PTZ00052499 thioredoxin reductase; Provisional 99.49
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.48
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 99.47
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.46
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.45
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.44
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 99.43
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.43
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.4
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.37
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.37
PRK13512438 coenzyme A disulfide reductase; Provisional 99.35
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.34
PRK10262321 thioredoxin reductase; Provisional 99.32
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.3
PLN02464627 glycerol-3-phosphate dehydrogenase 99.28
PRK10015429 oxidoreductase; Provisional 99.28
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.26
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.26
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.24
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.23
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.2
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.19
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.19
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.18
PRK12831464 putative oxidoreductase; Provisional 99.18
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.16
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.15
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.15
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.14
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.14
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.13
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.12
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.12
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.12
PLN02697529 lycopene epsilon cyclase 99.12
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.12
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.1
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 99.1
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.09
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.09
PRK06126545 hypothetical protein; Provisional 99.09
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.09
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.09
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.08
COG0579429 Predicted dehydrogenase [General function predicti 99.08
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.08
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.07
PRK10157428 putative oxidoreductase FixC; Provisional 99.06
PRK05257494 malate:quinone oxidoreductase; Validated 99.06
PRK11728393 hydroxyglutarate oxidase; Provisional 99.05
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.04
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.04
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.04
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.04
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.02
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.01
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.01
PLN02463447 lycopene beta cyclase 99.0
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.0
PRK12814652 putative NADPH-dependent glutamate synthase small 98.99
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.99
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.98
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.98
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.97
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.95
PRK06185407 hypothetical protein; Provisional 98.94
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.94
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.93
PLN02985514 squalene monooxygenase 98.93
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.93
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.92
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.91
PRK13984604 putative oxidoreductase; Provisional 98.91
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.9
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.9
PRK09126392 hypothetical protein; Provisional 98.89
PRK13977576 myosin-cross-reactive antigen; Provisional 98.89
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.89
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.87
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.87
PRK06184502 hypothetical protein; Provisional 98.86
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.86
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.86
PRK07045388 putative monooxygenase; Reviewed 98.84
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.84
PRK06834488 hypothetical protein; Provisional 98.84
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.84
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.83
PRK02106560 choline dehydrogenase; Validated 98.83
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.82
PRK08244493 hypothetical protein; Provisional 98.81
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.81
PRK07190487 hypothetical protein; Provisional 98.8
PRK08013400 oxidoreductase; Provisional 98.8
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.79
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.77
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.77
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.77
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.76
PRK11445351 putative oxidoreductase; Provisional 98.76
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.75
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.74
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.73
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.72
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.72
PRK06847375 hypothetical protein; Provisional 98.72
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.71
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.71
PRK07538413 hypothetical protein; Provisional 98.7
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.69
PLN02785587 Protein HOTHEAD 98.69
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.69
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.69
PRK08163396 salicylate hydroxylase; Provisional 98.68
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.68
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 98.65
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.64
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.64
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.63
PRK09897534 hypothetical protein; Provisional 98.59
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.59
PTZ00367567 squalene epoxidase; Provisional 98.58
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.57
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.57
PRK06475400 salicylate hydroxylase; Provisional 98.56
PRK06996398 hypothetical protein; Provisional 98.54
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.54
PRK07236386 hypothetical protein; Provisional 98.54
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.53
COG2303542 BetA Choline dehydrogenase and related flavoprotei 98.53
KOG2853509 consensus Possible oxidoreductase [General functio 98.53
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.49
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.49
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.49
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.48
PRK08294634 phenol 2-monooxygenase; Provisional 98.44
PRK07588391 hypothetical protein; Provisional 98.43
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.41
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.41
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.39
PRK07208479 hypothetical protein; Provisional 98.38
PRK06753373 hypothetical protein; Provisional 98.37
PRK05868372 hypothetical protein; Validated 98.35
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.33
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.3
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.3
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 98.29
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.29
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.27
PLN02612567 phytoene desaturase 98.19
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.19
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.19
KOG2852380 consensus Possible oxidoreductase [General functio 98.17
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.16
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.15
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.09
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.06
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.06
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 98.03
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.03
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.98
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 97.92
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.87
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.86
PLN02487569 zeta-carotene desaturase 97.78
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.75
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 97.73
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.72
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.7
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.67
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.66
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.65
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.65
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.62
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.57
PLN02576496 protoporphyrinogen oxidase 97.57
PRK07233434 hypothetical protein; Provisional 97.57
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.52
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.52
PLN02268435 probable polyamine oxidase 97.51
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.48
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.48
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.47
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.46
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.46
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.46
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.44
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.43
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.42
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.4
TIGR02053463 MerA mercuric reductase. This model represents the 97.39
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 97.36
PRK06370463 mercuric reductase; Validated 97.36
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.35
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.35
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.34
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.32
COG3349485 Uncharacterized conserved protein [Function unknow 97.32
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.25
PRK12831464 putative oxidoreductase; Provisional 97.25
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.24
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.23
PRK06116450 glutathione reductase; Validated 97.2
PRK10262321 thioredoxin reductase; Provisional 97.2
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.18
PRK12416463 protoporphyrinogen oxidase; Provisional 97.17
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.16
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.14
PLN02676487 polyamine oxidase 97.12
PLN02852491 ferredoxin-NADP+ reductase 97.11
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.11
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.08
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.07
PLN02529738 lysine-specific histone demethylase 1 97.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 96.99
PLN02328808 lysine-specific histone demethylase 1 homolog 96.98
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.97
PTZ00058561 glutathione reductase; Provisional 96.95
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 96.93
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.91
PTZ00153659 lipoamide dehydrogenase; Provisional 96.9
PLN02568539 polyamine oxidase 96.89
PLN02507499 glutathione reductase 96.86
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 96.86
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.84
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.82
PRK14727479 putative mercuric reductase; Provisional 96.81
PRK14694468 putative mercuric reductase; Provisional 96.8
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 96.78
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.77
PRK07845466 flavoprotein disulfide reductase; Reviewed 96.76
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.75
PRK065671028 putative bifunctional glutamate synthase subunit b 96.74
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.74
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 96.72
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.7
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.68
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.68
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.67
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.63
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.62
PRK07846451 mycothione reductase; Reviewed 96.62
PRK13748561 putative mercuric reductase; Provisional 96.61
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.59
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.58
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.57
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.52
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.48
PTZ00052499 thioredoxin reductase; Provisional 96.47
PRK13512438 coenzyme A disulfide reductase; Provisional 96.46
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.46
PLN02546558 glutathione reductase 96.42
PRK12779944 putative bifunctional glutamate synthase subunit b 96.4
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 96.35
PTZ00188506 adrenodoxin reductase; Provisional 96.34
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.32
PLN02976 1713 amine oxidase 96.31
PLN03000 881 amine oxidase 96.28
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.17
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.1
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.07
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 95.89
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 95.78
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.76
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 95.51
KOG0404322 consensus Thioredoxin reductase [Posttranslational 95.5
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.36
PRK12814652 putative NADPH-dependent glutamate synthase small 95.11
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.79
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 94.73
PRK12771564 putative glutamate synthase (NADPH) small subunit; 94.69
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 94.51
PRK065671028 putative bifunctional glutamate synthase subunit b 94.45
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 94.39
PRK13984604 putative oxidoreductase; Provisional 94.3
KOG03992142 consensus Glutamate synthase [Amino acid transport 94.06
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 93.92
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 93.64
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 93.52
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.47
PLN02852491 ferredoxin-NADP+ reductase 93.46
PRK098531019 putative selenate reductase subunit YgfK; Provisio 92.52
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 92.38
KOG2755334 consensus Oxidoreductase [General function predict 91.87
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 90.46
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.31
KOG2755334 consensus Oxidoreductase [General function predict 89.3
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.13
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 88.81
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 88.62
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 88.47
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 88.22
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 88.04
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 87.81
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 87.78
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 87.72
PRK15116268 sulfur acceptor protein CsdL; Provisional 87.47
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 87.46
COG0569225 TrkA K+ transport systems, NAD-binding component [ 87.03
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 86.77
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 86.76
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 86.73
PF01134392 GIDA: Glucose inhibited division protein A; InterP 86.35
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 85.68
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 85.51
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 85.42
KOG4716503 consensus Thioredoxin reductase [Posttranslational 85.26
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 84.94
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 84.94
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 84.89
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 84.8
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 84.69
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 84.5
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.21
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 84.03
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 83.93
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 83.92
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.91
PRK06718202 precorrin-2 dehydrogenase; Reviewed 83.5
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 83.32
PRK08328231 hypothetical protein; Provisional 82.89
PRK06719157 precorrin-2 dehydrogenase; Validated 82.79
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 82.27
PRK12549284 shikimate 5-dehydrogenase; Reviewed 82.13
PRK08223287 hypothetical protein; Validated 82.06
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 81.92
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 81.82
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 81.65
PLN02661357 Putative thiazole synthesis 81.59
PRK05708305 2-dehydropantoate 2-reductase; Provisional 81.13
COG4716587 Myosin-crossreactive antigen [Function unknown] 81.11
cd01483143 E1_enzyme_family Superfamily of activating enzymes 81.06
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 81.04
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 80.95
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 80.75
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 80.63
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 80.23
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.5e-109  Score=846.65  Aligned_cols=504  Identities=48%  Similarity=0.724  Sum_probs=450.8

Q ss_pred             CEEEECcchHHHHHHHHHHhcCCeEEEEecCCCCCCccccCCCeeeecCCCCCHHHHHHHHHHhcccCCCHHHHHHHHHH
Q 006387           90 DFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTE  169 (647)
Q Consensus        90 DVlVIGgG~AGl~AA~~aa~~G~V~llEk~~~~~G~t~~a~Ggi~~~~~~~d~~~~~~~~~~~~g~~~~~~~~~~~~~~~  169 (647)
                      ||+|||+|+|||++|+.|++.-+|+||.|.+...++|.|+||||.+..+++|+++.|+.||+.+|.++||++.++.++.+
T Consensus         9 dV~IiGsG~AGL~~AL~L~~~~~V~vltk~~~~~~sS~~AQGGIAa~~~~~Ds~~~Hv~DTL~AG~glcD~~aV~~iv~~   88 (518)
T COG0029           9 DVLIIGSGLAGLTAALSLAPSFRVTVLTKGPLGESSSYWAQGGIAAALSEDDSPELHVADTLAAGAGLCDEEAVEFIVSE   88 (518)
T ss_pred             cEEEECCcHHHHHHHHhCCCCCcEEEEeCCCCCCccchhhcCceEeeeCCCCCHHHHHHHHHHhcCCCCcHHHHHHHHHh
Confidence            99999999999999999998769999999999889999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHcCCCcccCCCCCccccccCCccccceeeccCCchHHHHHHHHHHHHcCCCcEEEcceEEEEEEecCCCCC
Q 006387          170 GPDRIRELIAIGASFDRGEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPD  249 (647)
Q Consensus       170 ~~~~i~~l~~~Gv~~~~~~~g~~~~~~~gg~~~~r~~~~~~~~g~~~~~~L~~~~~~~~gv~i~~~~~v~~l~~~~~g~~  249 (647)
                      ++++++||.++|++|+++.+|.+.+..+|+|+.+|++|..+.+|+.++.+|.++++++++|++++++.+.+|+.+++.  
T Consensus        89 ~~~ai~~Li~~Gv~FDr~~~g~~~lt~EggHS~rRIlH~~~~TG~~I~~~L~~~v~~~p~I~v~e~~~a~~li~~~~~--  166 (518)
T COG0029          89 APEAIEWLIDLGVPFDRDEDGRLHLTREGGHSRRRILHAADATGKEIMTALLKKVRNRPNITVLEGAEALDLIIEDGI--  166 (518)
T ss_pred             HHHHHHHHHHcCCCCcCCCCCceeeeeecccCCceEEEecCCccHHHHHHHHHHHhcCCCcEEEecchhhhhhhcCCc--
Confidence            999999999999999999999999999999999999999999999999999999999899999999999999998542  


Q ss_pred             CeEEEEEEEecCCCeEEEEEcCeEEECCCcccccCCCCCCCCCCcchHHHHHHHcCCeecCccccccccccccCCCCCCC
Q 006387          250 AVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTALADEGLPIK  329 (647)
Q Consensus       250 ~~v~Gv~~~~~~~g~~~~i~Ak~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~q~~p~~~~~~g~~~~  329 (647)
                       .+.|+.+.+... +...|+|+.|||||||.+++|..++||..++|||++||+++|+.+.||||+|||||.+..++.   
T Consensus       167 -~~~Gv~~~~~~~-~~~~~~a~~vVLATGG~g~ly~~TTNp~~~~GdGIamA~rAGa~v~DlEFvQFHPT~l~~~~~---  241 (518)
T COG0029         167 -GVAGVLVLNRNG-ELGTFRAKAVVLATGGLGGLYAYTTNPKGSTGDGIAMAWRAGAAVADLEFVQFHPTALYIPQR---  241 (518)
T ss_pred             -eEeEEEEecCCC-eEEEEecCeEEEecCCCcccccccCCCccccccHHHHHHHcCCeecCccceeeccceecCCCC---
Confidence             456999986433 678899999999999999999999999999999999999999999999999999999876432   


Q ss_pred             CCCCCCccceeeecccCCCceEEeCCCCccccccccccccCchhHHHHHHHHHHHhcCCCeEEEecCCCChhHHHhhChh
Q 006387          330 PKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPN  409 (647)
Q Consensus       330 p~~~~~~~~l~~e~~~~~g~~~vn~~G~rf~~~~~~~~~l~~rd~~~~~i~~~~~~~~~~~v~ld~~~~~~~~l~~~~~~  409 (647)
                            ..+|++|++||+|++|+|.+|+|||..|+|.+||+|||+|+++|+.|+++++.. ||||+++++.+.+.++||+
T Consensus       242 ------~~~LiSEAVRGEGA~L~~~~GeRFm~~~~p~~ELAPRDVVARAI~~e~~~~g~~-V~LD~s~~~~~~~~~rFP~  314 (518)
T COG0029         242 ------RAFLISEAVRGEGAILVNEDGERFMPDYHPRGELAPRDVVARAIDAEMKRGGAD-VFLDISHIPGDFFERRFPT  314 (518)
T ss_pred             ------ccceeehhhhcCccEEECCCCCccccCCCCccccchHHHHHHHHHHHHHhcCCe-EEEeccCCCchhhhhhCcH
Confidence                  278999999999999999999999999999999999999999999999997644 9999999998889999999


Q ss_pred             HHHHHHHcCCCCCCCCeeeeeeeceecCceEECCCCCcccCceeecccccCCCCCCCCccchhhhHHHHHHHHHHHHHHH
Q 006387          410 IAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSI  489 (647)
Q Consensus       410 ~~~~~~~~G~d~~~~~i~v~p~~~~~~GGi~vD~~~~T~ipGLyAaGe~a~~g~~Ga~rl~g~sl~~a~v~G~~Ag~~a~  489 (647)
                      +++.|.+.|+||.++||||.|++||+||||.||.++||+||||||+|||+|+|+||||||+||||+||+|||.+|+++++
T Consensus       315 I~~~c~~~GiD~~r~~IPV~PaaHY~mGGI~vD~~GrTsi~gLYAiGEvA~TGlHGANRLASNSLLE~vV~g~~aA~~i~  394 (518)
T COG0029         315 IYAACLKAGIDPTREPIPVVPAAHYTMGGIAVDANGRTSIPGLYAIGEVACTGLHGANRLASNSLLECLVFGKRAAEDIA  394 (518)
T ss_pred             HHHHHHHcCCCcccCccCccchhheecccEEECCCCcccCcccEEeeeecccccccchhhhhhhHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HhhhcccccccccccccccccCcccccccchhhhhcHHHHHHHHHHHHHhcCccccCHHHHHHHHHHHHHHHHHHHHhhh
Q 006387          490 DHKKSTSIDLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLF  569 (647)
Q Consensus       490 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~g~~r~~~~l~~al~~l~~l~~~~~~~~~  569 (647)
                      ...............+.      ....      ......-+++||++||+|+||+|+.++|++++.+|+.++++....  
T Consensus       395 ~~~~~~~~~~~~~~~~~------~~~~------~~~~~~~~~~Lr~~m~~~~GI~R~~~~L~~~~~~l~~~~~~~~~~--  460 (518)
T COG0029         395 GRLAPAPREAPTLPVRD------DYEE------NVLLAHDRHELRRLMWRYVGIVRTAKGLERAIRRLEPLQQENDEY--  460 (518)
T ss_pred             cccccCccCCCCCCccc------cccc------ccccccCHHHHHHHHHhhcceEechHHHHHHHHHHHhhhhhhhhc--
Confidence            76532221000000000      0000      011122357899999999999999999999999999998775532  


Q ss_pred             ccCcccccchHHHHHHHhHHHHHHHHHHHHHhcCcCcccccccCCCCCccCCCCCeeecCC
Q 006387          570 EHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHVEENKRLPTIILPS  630 (647)
Q Consensus       570 ~~~~~~~~~~~~~~e~~~~l~~a~~~~~aal~R~ESRG~h~R~D~P~~d~~~~~~~~~~~~  630 (647)
                           .+.+.    +-+|++++|++|+++||+|+||||+|||.|||.+.+++...+++.+.
T Consensus       461 -----~~~~~----~~~nl~~vA~li~~~Al~R~ESRG~H~r~D~P~~~~~~~~~~~~~~~  512 (518)
T COG0029         461 -----ANFRV----SNRNLALVALLIARAALLRTESRGAHFRLDYPDTLPEAQRRILVTLN  512 (518)
T ss_pred             -----ccccc----cccCHHHHHHHHHHHHHhccccccceecccCCCcCccccCceEEecc
Confidence                 01111    12899999999999999999999999999999999998888877653

>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF02910 Succ_DH_flav_C: Fumarate reductase flavoprotein C-term; InterPro: IPR004112 In bacteria two distinct, membrane-bound, enzyme complexes are responsible for the interconversion of fumarate and succinate (1 Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
1chu_A540 Structure Of L-Aspartate Oxidase: Implications For 1e-111
1knp_A540 E. Coli L-aspartate Oxidase: Mutant R386l In Comple 1e-111
2e5v_A472 Crystal Structure Of L-Aspartate Oxidase From Hyper 1e-64
1zoy_A622 Crystal Structure Of Mitochondrial Respiratory Comp 2e-62
1nek_A588 Complex Ii (Succinate Dehydrogenase) From E. Coli W 4e-62
2b76_A602 E. Coli Quinol Fumarate Reductase Frda E49q Mutatio 6e-62
1kf6_A602 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 2e-61
3p4r_A577 Crystal Structure Of Menaquinol:fumarate Oxidoreduc 2e-61
3cir_A602 E. Coli Quinol Fumarate Reductase Frda T234a Mutati 6e-61
1yq3_A621 Avian Respiratory Complex Ii With Oxaloacetate And 7e-61
2bs2_A660 Quinol:fumarate Reductase From Wolinella Succinogen 1e-58
1e7p_A656 Quinol:fumarate Reductase From Wolinella Succinogen 1e-58
1qlb_A656 Respiratory Complex Ii-Like Fumarate Reductase From 4e-58
3vr8_A645 Mitochondrial Rhodoquinol-Fumarate Reductase From T 5e-57
1qo8_A566 The Structure Of The Open Conformation Of A Flavocy 4e-20
1ksu_A571 Crystal Structure Of His505tyr Mutant Flavocytochro 5e-17
1p2h_A571 H61m Mutant Of Flavocytochrome C3 Length = 571 3e-16
1qjd_A571 Flavocytochrome C3 From Shewanella Frigidimarina Le 3e-16
1p2e_A571 H61a Mutant Of Flavocytochrome C3 Length = 571 3e-16
1jrz_A571 Crystal Structure Of Arg402tyr Mutant Flavocytochro 4e-16
1jry_A571 Crystal Structure Of Arg402lys Mutant Flavocytochro 7e-16
2b7s_A571 R381k Mutant Of Flavocytochrome C3 Length = 571 7e-16
2b7r_A571 Structure Of E378d Mutant Flavocytochrome C3 Length 7e-16
1kss_A571 Crystal Structure Of His505ala Mutant Flavocytochro 7e-16
1jrx_A571 Crystal Structure Of Arg402ala Mutant Flavocytochro 8e-16
1q9i_A571 The A251c:s430c Double Mutant Of Flavocytochrome C3 1e-15
1m64_A571 Crystal Structure Of Q363f Mutant Flavocytochrome C 3e-15
1e39_A571 Flavocytochrome C3 From Shewanella Frigidimarina Hi 4e-15
1d4c_A572 Crystal Structure Of The Uncomplexed Form Of The Fl 7e-15
1lj1_A571 Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHR 9e-15
1d4d_A572 Crystal Structure Of The Succinate Complexed Form O 1e-14
>pdb|1CHU|A Chain A, Structure Of L-Aspartate Oxidase: Implications For The Succinate Dehydrogenase FUMARATE REDUCATSE FAMILY Length = 540 Back     alignment and structure 
Iteration: 1

 Score =  400 bits (1028), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 240/568 (42%), Positives = 328/568 (57%), Gaps = 45/568 (7%)
Query: 72  LRTVPVLSCLRDGSVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQG 131
           + T+P  SC         D  +IGSG AGL  AL +A    V V++K    E +T YAQG
Sbjct: 1   MNTLPEHSC---------DVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEGSTFYAQG 51
Query: 132 GVSAVLCPSDSVESHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFD-----R 186
           G++AV   +DS++SH++DT++AGA +CD   V  V +     ++ LI  G  FD      
Sbjct: 52  GIAAVFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPN 111
Query: 187 GEDGNLHLAREGGHSHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTT-- 244
           GE+ + HL REGGHSH RI+HAAD TGRE+E  L+   ++ PNI V E   A+DL+ +  
Sbjct: 112 GEE-SYHLTREGGHSHRRILHAADATGREVETTLVSKALNHPNIRVLERTNAVDLIVSDK 170
Query: 245 --LDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAH 302
             L G   V  G    N   + V    +K  +LA+GGA  +Y  TTNP +++GDG+AMA 
Sbjct: 171 IGLPGTRRVV-GAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAW 229
Query: 303 RAQAVISNMEFVQFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPL 362
           RA   ++N+EF QFHPTAL            +  +FL+TEA+RG+G  L      RFMP 
Sbjct: 230 RAGCRVANLEFNQFHPTAL---------YHPQARNFLLTEALRGEGAYLKRPDGTRFMPD 280
Query: 363 YDERAELAPRDVVARSIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDIT 422
           +DER ELAPRD+VAR+ID ++K+     + LDISHKP + I  HFP I  + L  G+D+T
Sbjct: 281 FDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLT 340
Query: 423 SQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFAR 482
            +P+P+VPAAHY CGGV     G T+V GLY  GEV+ TGLHGANR+ASNSLLE LV+  
Sbjct: 341 QEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGW 400
Query: 483 RAVQPSIDHKKSTSIDLSASNWWTRTVVPK-SLGCNVMHNILRRTKEVRKELQSIMWRYV 541
            A +  I  +   + D+S    W  + V        + HN          EL+  MW YV
Sbjct: 401 SAAE-DITRRMPYAHDISTLPPWDESRVENPDERVVIQHNW--------HELRLFMWDYV 451
Query: 542 GIVRSTTSLQTAEWRIDELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALA 601
           GIVR+T  L+ A  RI  L+ E + Y     +    V     E+RNL   A+L+V  A+ 
Sbjct: 452 GIVRTTKRLERALRRITMLQQEIDEY-----YAHFRVSNNLLELRNLVQVAELIVRCAMM 506
Query: 602 RHESRGLHYMVDFPHVEENKRLPTIILP 629
           R ESRGLH+ +D+P +  +   P+I+ P
Sbjct: 507 RKESRGLHFTLDYPELLTHSG-PSILSP 533
>pdb|1KNP|A Chain A, E. Coli L-aspartate Oxidase: Mutant R386l In Complex With Succinate Length = 540 Back     alignment and structure
>pdb|2E5V|A Chain A, Crystal Structure Of L-Aspartate Oxidase From Hyperthermophilic Archaeon Sulfolobus Tokodaii Length = 472 Back     alignment and structure
>pdb|1ZOY|A Chain A, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 622 Back     alignment and structure
>pdb|1NEK|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 588 Back     alignment and structure
>pdb|2B76|A Chain A, E. Coli Quinol Fumarate Reductase Frda E49q Mutation Length = 602 Back     alignment and structure
>pdb|1KF6|A Chain A, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 602 Back     alignment and structure
>pdb|3P4R|A Chain A, Crystal Structure Of Menaquinol:fumarate Oxidoreductase In Complex With Glutarate Length = 577 Back     alignment and structure
>pdb|3CIR|A Chain A, E. Coli Quinol Fumarate Reductase Frda T234a Mutation Length = 602 Back     alignment and structure
>pdb|1YQ3|A Chain A, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 621 Back     alignment and structure
>pdb|2BS2|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 660 Back     alignment and structure
>pdb|1E7P|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|1QLB|A Chain A, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|3VR8|A Chain A, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 645 Back     alignment and structure
>pdb|1QO8|A Chain A, The Structure Of The Open Conformation Of A Flavocytochrome C3 Fumarate Reductase Length = 566 Back     alignment and structure
>pdb|1KSU|A Chain A, Crystal Structure Of His505tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1P2H|A Chain A, H61m Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1QJD|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1P2E|A Chain A, H61a Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1JRZ|A Chain A, Crystal Structure Of Arg402tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRY|A Chain A, Crystal Structure Of Arg402lys Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|2B7S|A Chain A, R381k Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|2B7R|A Chain A, Structure Of E378d Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1KSS|A Chain A, Crystal Structure Of His505ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRX|A Chain A, Crystal Structure Of Arg402ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1Q9I|A Chain A, The A251c:s430c Double Mutant Of Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1M64|A Chain A, Crystal Structure Of Q363f Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1E39|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Histidine 365 Mutated To Alanine Length = 571 Back     alignment and structure
>pdb|1D4C|A Chain A, Crystal Structure Of The Uncomplexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure
>pdb|1LJ1|A Chain A, Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHROME C3 Length = 571 Back     alignment and structure
>pdb|1D4D|A Chain A, Crystal Structure Of The Succinate Complexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 0.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 0.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 1e-167
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 1e-163
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 1e-159
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 1e-156
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 4e-95
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 3e-83
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 9e-83
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 5e-80
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 4e-64
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-37
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 Back     alignment and structure
 Score =  773 bits (1998), Expect = 0.0
 Identities = 228/553 (41%), Positives = 310/553 (56%), Gaps = 30/553 (5%)

Query: 85  SVKYFDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVE 144
                D  +IGSG AGL  AL +A    V V++K    E +T YAQGG++AV   +DS++
Sbjct: 5   PEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEGSTFYAQGGIAAVFDETDSID 64

Query: 145 SHMQDTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDR----GEDGNLHLAREGGH 200
           SH++DT++AGA +CD   V  V +     ++ LI  G  FD       + + HL REGGH
Sbjct: 65  SHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPNGEESYHLTREGGH 124

Query: 201 SHHRIVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDGPDAV---CHGVDT 257
           SH RI+HAAD TGRE+E  L+   ++ PNI V E   A+DL+ +            G   
Sbjct: 125 SHRRILHAADATGREVETTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWV 184

Query: 258 LNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFH 317
            N   + V    +K  +LA+GGA  +Y  TTNP +++GDG+AMA RA   ++N+EF QFH
Sbjct: 185 WNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFH 244

Query: 318 PTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVAR 377
           PTAL               +FL+TEA+RG+G  L      RFMP +DER ELAPRD+VAR
Sbjct: 245 PTALYHPQAR---------NFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVAR 295

Query: 378 SIDDQLKKRNEKYVLLDISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCG 437
           +ID ++K+     + LDISHKP + I  HFP I  + L  G+D+T +P+P+VPAAHY CG
Sbjct: 296 AIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCG 355

Query: 438 GVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSI 497
           GV     G T+V GLY  GEV+ TGLHGANR+ASNSLLE LV+   A +           
Sbjct: 356 GVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMPYAHD 415

Query: 498 DLSASNWWTRTVVPKSLGCNVMHNILRRTKEVRKELQSIMWRYVGIVRSTTSLQTAEWRI 557
             +   W    V        + HN          EL+  MW YVGIVR+T  L+ A  RI
Sbjct: 416 ISTLPPWDESRVENPDERVVIQHN--------WHELRLFMWDYVGIVRTTKRLERALRRI 467

Query: 558 DELEAEWETYLFEHGWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMVDFPHV 617
             L+ E + Y     +    V     E+RNL   A+L+V  A+ R ESRGLH+ +D+P +
Sbjct: 468 TMLQQEIDEY-----YAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPEL 522

Query: 618 EENKRLPTIILPS 630
             +   P+I+ P 
Sbjct: 523 LTHSG-PSILSPG 534
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query647
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 100.0
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 100.0
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 100.0
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 100.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 100.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 100.0
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 100.0
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 100.0
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 100.0
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.97
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.89
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.85
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.71
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.69
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.68
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.66
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.66
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.65
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.63
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.6
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.59
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.59
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.59
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.57
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.57
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.56
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.56
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.54
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.53
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.51
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.51
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.51
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.51
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.51
4dna_A463 Probable glutathione reductase; structural genomic 99.5
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.5
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.49
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.49
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.48
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.47
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.47
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.44
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.43
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.43
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.43
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.43
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.43
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.42
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.42
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.41
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.41
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.41
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.41
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.4
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.4
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.4
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.4
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.39
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.39
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.39
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.38
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.37
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.36
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.36
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.36
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.34
3dme_A369 Conserved exported protein; structural genomics, P 99.34
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.34
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.34
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.33
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.33
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.32
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.32
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.32
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.31
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.31
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.3
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.3
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.29
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.28
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.28
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.28
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.27
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.27
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.27
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.27
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.26
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.25
3atr_A453 Conserved archaeal protein; saturating double bond 99.25
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.24
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.23
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 99.22
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.22
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.22
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.21
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.2
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.2
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.2
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.19
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.18
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.17
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.17
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.16
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.16
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.15
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.15
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.14
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.14
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.13
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.12
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.12
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 99.12
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.12
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.1
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.1
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.08
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.07
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.04
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.03
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.0
2cul_A232 Glucose-inhibited division protein A-related PROT 98.97
2bry_A497 NEDD9 interacting protein with calponin homology a 98.97
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.95
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.94
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.92
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.92
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.91
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.9
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.9
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.9
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.89
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.89
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.87
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.87
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.85
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.85
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.81
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.81
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.79
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.79
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.77
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.76
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.75
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.75
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.75
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.74
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.74
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.73
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.73
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.73
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.71
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.71
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.7
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.7
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.69
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.68
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.65
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.63
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.63
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.58
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.56
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.55
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.53
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.52
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.51
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.5
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.49
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.48
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.48
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.47
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.45
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.39
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.39
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.37
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.33
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.26
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.17
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.13
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.09
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.08
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.93
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.86
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.82
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.77
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.76
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.76
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.74
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.72
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.7
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.69
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.68
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.67
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.66
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.65
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.64
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.64
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.63
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.61
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.61
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.6
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.6
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.6
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.58
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.58
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.57
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.57
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.56
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.55
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.54
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.54
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.53
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.52
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.52
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.51
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.51
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.51
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.5
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.5
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.5
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.47
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.46
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.46
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.44
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.44
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.44
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.43
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.42
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.41
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.4
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.39
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.38
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.37
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.34
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.33
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.29
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.28
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.26
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.26
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.24
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.24
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.21
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.2
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.18
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.18
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.17
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.17
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.16
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.13
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.1
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.09
4dna_A463 Probable glutathione reductase; structural genomic 97.09
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.08
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.08
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.04
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.03
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.01
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.0
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.98
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.97
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.95
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.94
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.92
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.91
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.9
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.87
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.72
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.71
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.63
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.6
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.52
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.4
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.4
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.38
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.37
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.35
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.31
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.29
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.22
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.02
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 95.86
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.81
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 95.8
2lfc_A160 Fumarate reductase, flavoprotein subunit; structur 95.53
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 95.37
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 95.25
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.25
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.19
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.96
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.61
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 94.28
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 93.2
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 91.99
4fk1_A304 Putative thioredoxin reductase; structural genomic 91.54
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.47
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 91.41
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 91.06
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 90.62
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.51
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.76
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 89.34
2cul_A232 Glucose-inhibited division protein A-related PROT 89.23
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 88.72
1lss_A140 TRK system potassium uptake protein TRKA homolog; 88.52
1id1_A153 Putative potassium channel protein; RCK domain, E. 87.86
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.17
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.24
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 86.2
3c85_A183 Putative glutathione-regulated potassium-efflux S 85.57
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 85.54
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 85.16
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 85.14
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 84.9
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 84.28
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 83.93
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 83.91
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 83.41
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 83.29
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 82.91
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 82.81
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 82.07
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 81.87
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 81.67
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 80.95
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 80.87
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 80.62
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 80.09
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
Probab=100.00  E-value=5.2e-91  Score=781.88  Aligned_cols=512  Identities=34%  Similarity=0.517  Sum_probs=446.9

Q ss_pred             ccccCEEEECcchHHHHHHHHHHhcC-CeEEEEecCCCCCCccccCCCeeeecC--CCCCHHHHHHHHHHhcccCCCHHH
Q 006387           86 VKYFDFSVIGSGVAGLCYALEVAKHG-TVAVITKAEPHESNTNYAQGGVSAVLC--PSDSVESHMQDTIVAGAYLCDDET  162 (647)
Q Consensus        86 ~~~~DVlVIGgG~AGl~AA~~aa~~G-~V~llEk~~~~~G~t~~a~Ggi~~~~~--~~d~~~~~~~~~~~~g~~~~~~~~  162 (647)
                      +.++||||||||+|||+||+.|++.| +|+||||....+|+|.+++||+++..+  ..|+++.|+.|+++.+.++++++.
T Consensus        16 ~~~~DVvVVG~G~AGl~AAl~aa~~G~~V~vlEK~~~~~g~s~~a~GGi~a~~~~~~~ds~~~~~~dtl~~g~~l~d~~~   95 (621)
T 2h88_A           16 DHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDA   95 (621)
T ss_dssp             EEEEEEEEECCSHHHHHHHHHHHHTTCCEEEEESSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHTTTCSCHHH
T ss_pred             cccCCEEEECccHHHHHHHHHHHHCCCcEEEEeccCCCCCCchhhCCCcEecCCCCCCCCHHHHHHHHHHhcCCCCCHHH
Confidence            45799999999999999999999999 999999998888888899999987654  358899999999999999999999


Q ss_pred             HHHHHHHhHHHHHHHHHcCCCcccCCCCCccccccCCcccc--------ceeeccCCchHHHHHHHHHHHHcCCCcEEEc
Q 006387          163 VRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHSHH--------RIVHAADMTGREIERALLEAVVSDPNISVFE  234 (647)
Q Consensus       163 ~~~~~~~~~~~i~~l~~~Gv~~~~~~~g~~~~~~~gg~~~~--------r~~~~~~~~g~~~~~~L~~~~~~~~gv~i~~  234 (647)
                      ++.+++++++.++||.++|++|.+..+|.+....+++++.+        |+++..+.+|..++..|.+.+.+ .||+|++
T Consensus        96 v~~l~~~s~~~i~~L~~~Gv~f~~~~~g~~~~~~~gg~s~~~g~~~~~~R~~~~~d~tG~~l~~~L~~~~~~-~gv~i~~  174 (621)
T 2h88_A           96 IHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLR-YDTSYFV  174 (621)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCBCTTSSBCEECCTTCBSTTTTSCBCCCEECSTTCHHHHHHHHHHHHHTT-SCCEEEE
T ss_pred             HHHHHHHHHHHHHHHHHcCCCcccCCCCceeccccCcccccccCCCcceeEEEecCCCHHHHHHHHHHHHHh-CCCEEEE
Confidence            99999999999999999999999888888887788888776        88888888999999999999987 5999999


Q ss_pred             ceEEEEEEecCCCCCCeEEEEEEEecCCCeEEEEEcCeEEECCCcccccCCCCCCCCCCcchHHHHHHHcCCeecCcccc
Q 006387          235 HHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFV  314 (647)
Q Consensus       235 ~~~v~~l~~~~~g~~~~v~Gv~~~~~~~g~~~~i~Ak~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~  314 (647)
                      ++.|++|+.+ ++   +|.||.+.+..+|+...|+|+.|||||||++.+|..++++..+||||+.||+++||.+.+|||+
T Consensus       175 ~~~v~~Li~~-~g---~v~Gv~~~~~~~G~~~~i~A~~VVlATGG~~~~y~~~t~~~~~tGdG~~mA~raGa~l~~me~~  250 (621)
T 2h88_A          175 EYFALDLLME-NG---ECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFV  250 (621)
T ss_dssp             TEEEEEEEEE-TT---EEEEEEEEETTTCCEEEEEEEEEEECCCCCGGGSSSBSSCTTCCCHHHHHHHHTTCCEECTTCE
T ss_pred             ceEEEEEEEE-CC---EEEEEEEEEcCCCcEEEEEcCeEEECCCccccccCCcCCCCCCChHHHHHHHHcCCCcccCcce
Confidence            9999999986 55   8999999886778888899999999999999999989999999999999999999999999999


Q ss_pred             ccccccccCCCCCCCCCCCCCccceeeecccCCCceEEeCCCCccccccccc-cccCchhHHHHHHHHHHHhcCC-----
Q 006387          315 QFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDER-AELAPRDVVARSIDDQLKKRNE-----  388 (647)
Q Consensus       315 q~~p~~~~~~g~~~~p~~~~~~~~l~~e~~~~~g~~~vn~~G~rf~~~~~~~-~~l~~rd~~~~~i~~~~~~~~~-----  388 (647)
                      ||||+.+...            .++++|++|++|++++|.+|+|||++|.+. .++++||+++++|..++.++.+     
T Consensus       251 q~hPt~~~~~------------~~l~se~~rg~g~ilvn~~G~RF~~~y~p~~~ela~rdvv~rai~~e~~~g~g~~~~~  318 (621)
T 2h88_A          251 QFHPTGIYGA------------GCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEK  318 (621)
T ss_dssp             EEEEEEETTT------------CCBCCTHHHHTTCEEECTTCCCTHHHHSTTTGGGSCHHHHHHHHHHHHHTTCCBTTTT
T ss_pred             eeecccccCC------------cceecccccCCccEEECCCCCCcccccCcccccccchHHHHHHHHHHHHhcCCcccCC
Confidence            9999987532            467889999999999999999999999876 4899999999999988876542     


Q ss_pred             CeEEEecCCCChhHHHhhChhHHHHHHHc-CCCCCCCCeeeeeeeceecCceEECCCCC---------cccCceeecccc
Q 006387          389 KYVLLDISHKPTEKILSHFPNIAAECLKY-GLDITSQPIPVVPAAHYMCGGVRAGLQGE---------TNVRGLYVAGEV  458 (647)
Q Consensus       389 ~~v~ld~~~~~~~~l~~~~~~~~~~~~~~-G~d~~~~~i~v~p~~~~~~GGi~vD~~~~---------T~ipGLyAaGe~  458 (647)
                      ..||+|+++++.+.+.+++|++.+.+..+ |+|+.++|++|.|+.||+||||+||.++|         |+||||||||||
T Consensus       319 ~~v~ld~~~l~~~~l~~~~~~i~~~~~~~~G~D~~~~pi~v~p~~h~tmGGi~~d~~~~Vl~~~~~~~t~IpGLyAaGE~  398 (621)
T 2h88_A          319 DHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEA  398 (621)
T ss_dssp             CBEEEECTTSCHHHHHHHCHHHHHHHHHHHCCCTTTSCEEEEEEEEEESCBEEBCTTSEEEEEETTEEEEEEEEEECGGG
T ss_pred             CeEEEEcccCCHHHHHHHHHHHHHHHHHhcCCCCCCCCEEEEeecccccCcEeECCCCeEeecccCCCcccCceEEcccc
Confidence            45999999999999999999999998886 99999999999999999999999999987         799999999999


Q ss_pred             cCCCCCCCCccchhhhHHHHHHHHHHHHHHHHhhhcccccccccccccccccCcccccccch-----hhhhcHHHHHHHH
Q 006387          459 ACTGLHGANRLASNSLLEALVFARRAVQPSIDHKKSTSIDLSASNWWTRTVVPKSLGCNVMH-----NILRRTKEVRKEL  533 (647)
Q Consensus       459 a~~g~~Ga~rl~g~sl~~a~v~G~~Ag~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~l  533 (647)
                      +|+|+||+|||+||||++|+|||++||++|+++++.... ...   .....  ......++.     +....+.+++.+|
T Consensus       399 a~~g~hGanrlggnsL~~~~vfGr~Ag~~aa~~~~~~~~-~~~---~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~l  472 (621)
T 2h88_A          399 ASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEP-VPS---IKPNA--GEESVANLDKLRFADGTIRTSEARLNM  472 (621)
T ss_dssp             EECSSSTTSCCTTSHHHHHHHHHHHHHHHHHHHCCTTCC-CCC---CCTTT--THHHHHHHHHHHTCBSSEEHHHHHHHH
T ss_pred             ccccccCCCCCchHhHHHHHHHHHHHHHHHHHhhhcccc-ccc---cchhH--HHHHHHHHHHhhccCCCCCHHHHHHHH
Confidence            988999999999999999999999999999988642210 000   00000  000000000     1124578899999


Q ss_pred             HHHHHhcCccccCHHHHHHHHHHHHHHHHHHHHhhhcc-CcccccchHHHHHHHhHHHHHHHHHHHHHhcCcCccccccc
Q 006387          534 QSIMWRYVGIVRSTTSLQTAEWRIDELEAEWETYLFEH-GWEQTFVGLEACEMRNLFCCAKLVVSSALARHESRGLHYMV  612 (647)
Q Consensus       534 ~~~m~~~~g~~r~~~~l~~al~~l~~l~~~~~~~~~~~-~~~~~~~~~~~~e~~~~l~~a~~~~~aal~R~ESRG~h~R~  612 (647)
                      |++||+|+||+|++++|++|+++|++|++++.++...+ ....++++++++|++|||++|+++++|||.|+||||+|||+
T Consensus       473 ~~~m~~~~gi~R~~~~L~~a~~~l~~l~~~~~~~~~~~~~~~~n~~l~~~~e~~~~l~~a~~~~~~al~R~ESRG~H~R~  552 (621)
T 2h88_A          473 QKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHARE  552 (621)
T ss_dssp             HHHHHHHSSSSBCHHHHHHHHHHHHHHHHGGGGEECCCCCSTTCHHHHHHHHHHHHHHHHHHHHHHHHHCCSCBTTBCBT
T ss_pred             HHHhhhceeEecCHHHHHHHHHHHHHHHHHHhhccccccccccchhHHHHHHHHHHHHHHHHHHHHHHhCcccccceecc
Confidence            99999999999999999999999999998875533221 12236788999999999999999999999999999999999


Q ss_pred             CCCCCccC
Q 006387          613 DFPHVEEN  620 (647)
Q Consensus       613 D~P~~d~~  620 (647)
                      |||++||+
T Consensus       553 D~p~~dd~  560 (621)
T 2h88_A          553 DYKLRIDE  560 (621)
T ss_dssp             TBCSCCCS
T ss_pred             cCcccCcc
Confidence            99999998
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2lfc_A Fumarate reductase, flavoprotein subunit; structural genomics, northeast structural genomics consortiu PSI-biology; NMR {Lactobacillus plantarum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 647
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 6e-61
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-13
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-58
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 5e-12
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 7e-55
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 1e-05
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 8e-49
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 7e-46
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-07
d1chua3116 d.168.1.1 (A:238-353) L-aspartate oxidase {Escheri 3e-37
d1neka3120 d.168.1.1 (A:236-355) Succinate dehydogenase {Esch 7e-37
d1kf6a3132 d.168.1.1 (A:226-357) Fumarate reductase {Escheric 8e-32
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 2e-29
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-09
d2bs2a3121 d.168.1.1 (A:251-371) Fumarate reductase {Wolinell 1e-28
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-23
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 9e-13
d1chua1111 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherich 6e-23
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 9e-21
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 5e-14
d1neka1138 a.7.3.1 (A:451-588) Succinate dehydogenase {Escher 1e-17
d1d4ca3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 1e-17
d1kf6a1134 a.7.3.1 (A:443-576) Fumarate reductase {Escherichi 2e-17
d2bs2a1198 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella 2e-16
d1y0pa3143 d.168.1.1 (A:362-504) Flavocytochrome c3 (respirat 5e-16
d1jnra1141 a.7.3.1 (A:503-643) Adenylylsulfate reductase A su 7e-15
d1qo8a3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 7e-15
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 7e-08
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 5e-04
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: L-aspartate oxidase
species: Escherichia coli [TaxId: 562]

 Score =  203 bits (517), Expect = 6e-61
 Identities = 101/301 (33%), Positives = 147/301 (48%), Gaps = 18/301 (5%)

Query: 89  FDFSVIGSGVAGLCYALEVAKHGTVAVITKAEPHESNTNYAQGGVSAVLCPSDSVESHMQ 148
            D  +IGSG AGL  AL +A    V V++K    E +T YAQGG++AV   +DS++SH++
Sbjct: 8   CDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEGSTFYAQGGIAAVFDETDSIDSHVE 67

Query: 149 DTIVAGAYLCDDETVRVVCTEGPDRIRELIAIGASFDRGE----DGNLHLAREGGHSHHR 204
           DT++AGA +CD   V  V +     ++ LI  G  FD       + + HL REGGHSH R
Sbjct: 68  DTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPNGEESYHLTREGGHSHRR 127

Query: 205 IVHAADMTGREIERALLEAVVSDPNISVFEHHFAIDLLTTLDG---PDAVCHGVDTLNVE 261
           I+HAAD TGRE+E  L+   ++ PNI V E   A+DL+ +            G    N  
Sbjct: 128 ILHAADATGREVETTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRN 187

Query: 262 TQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFVQFHPTAL 321
            + V    +K  +LA+GGA  +Y  TTNP +++GDG+AMA RA   ++N   V       
Sbjct: 188 KETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANCGGVMVDDHGR 247

Query: 322 ADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDD 381
            D       +       +    + G   +  N  +E  +         A  D+  R    
Sbjct: 248 TD------VEGLYAIGEVSYTGLHGANRMASNSLLECLVY-----GWSAAEDITRRMPYA 296

Query: 382 Q 382
            
Sbjct: 297 H 297
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 121 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 146 Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 134 Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 198 Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 143 Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 141 Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 146 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query647
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 100.0
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 100.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 100.0
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.98
d1neka1138 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.94
d1chua3116 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.93
d1jnra1141 Adenylylsulfate reductase A subunit {Archaeon Arch 99.93
d1kf6a1134 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.93
d2bs2a1198 Fumarate reductase {Wolinella succinogenes [TaxId: 99.92
d2bs2a3121 Fumarate reductase {Wolinella succinogenes [TaxId: 99.91
d1chua1111 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.91
d1kf6a3132 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.9
d1neka3120 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.89
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.88
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.86
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.67
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.6
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.56
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.55
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.54
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.52
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.51
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.5
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.49
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.44
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.43
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.43
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.4
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.4
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.37
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.26
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.25
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.15
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.08
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.05
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.05
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.05
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.03
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.02
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.02
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.99
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.92
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.88
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.86
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.84
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.83
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.75
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.74
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.72
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.72
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.7
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.68
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.68
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.64
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.64
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.63
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.62
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.61
d1qo8a3146 Flavocytochrome c3 (respiratory fumarate reductase 98.6
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.6
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.59
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.59
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.58
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.53
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.53
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.47
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.46
d1d4ca3146 Flavocytochrome c3 (respiratory fumarate reductase 98.43
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.4
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.37
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.36
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.36
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.33
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.32
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.28
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.26
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.24
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.24
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.21
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.19
d1y0pa3143 Flavocytochrome c3 (respiratory fumarate reductase 98.15
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.13
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.07
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.04
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.02
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.89
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.81
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.81
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.8
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.76
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.66
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.6
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.51
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.51
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.31
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.28
d1jnra3145 Adenylylsulfate reductase A subunit {Archaeon Arch 97.21
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.89
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.83
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.57
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.11
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.0
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.79
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.69
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.6
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.53
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 95.32
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.08
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.86
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.32
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.28
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.23
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.71
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.31
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.29
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.25
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.05
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.17
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.03
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 89.79
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.01
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 88.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.42
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.36
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.65
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 87.4
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 86.79
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.62
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 85.77
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 85.52
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 84.83
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 84.54
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.2
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.12
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 83.94
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.47
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 83.28
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.19
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 82.55
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.4
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.07
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 82.03
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 81.67
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 81.06
d1id1a_153 Rck domain from putative potassium channel Kch {Es 81.02
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 80.92
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 80.27
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2e-47  Score=397.63  Aligned_cols=292  Identities=39%  Similarity=0.590  Sum_probs=256.1

Q ss_pred             CccccCEEEECcchHHHHHHHHHHhcC-CeEEEEecCCCCCCccccCCCeeeecC--CCCCHHHHHHHHHHhcccCCCHH
Q 006387           85 SVKYFDFSVIGSGVAGLCYALEVAKHG-TVAVITKAEPHESNTNYAQGGVSAVLC--PSDSVESHMQDTIVAGAYLCDDE  161 (647)
Q Consensus        85 ~~~~~DVlVIGgG~AGl~AA~~aa~~G-~V~llEk~~~~~G~t~~a~Ggi~~~~~--~~d~~~~~~~~~~~~g~~~~~~~  161 (647)
                      +.++|||||||+|+|||+||++|+++| +|+||||.+..+|+|.+++|||++...  .+|+++.|++|+++.+.+++|++
T Consensus         4 ~~~~~DVlVVG~G~AGl~AAl~aa~~G~~V~lleK~~~~gg~s~~A~GGi~a~~~~~~~Ds~e~~~~Dtl~aG~~l~d~~   83 (330)
T d1neka2           4 PVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQD   83 (330)
T ss_dssp             CEEEESCEEECCSHHHHHHHHHHHHTTCCCEEECSSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHHTSCSCHH
T ss_pred             CcccCCEEEECcCHHHHHHHHHHHHcCCeEEEEeCCCCCCCcHHHHhhhHheEcCCCCCCCHHHHHHHHHHhhhhccCHH
Confidence            356899999999999999999999999 999999999999999999999998764  46999999999999999999999


Q ss_pred             HHHHHHHHhHHHHHHHHHcCCCcccCCCCCccccccCCcc-------ccceeeccCCchHHHHHHHHHHHHcCCCcEEEc
Q 006387          162 TVRVVCTEGPDRIRELIAIGASFDRGEDGNLHLAREGGHS-------HHRIVHAADMTGREIERALLEAVVSDPNISVFE  234 (647)
Q Consensus       162 ~~~~~~~~~~~~i~~l~~~Gv~~~~~~~g~~~~~~~gg~~-------~~r~~~~~~~~g~~~~~~L~~~~~~~~gv~i~~  234 (647)
                      +++.+++++++.++||+++|++|+++++|.+.....++++       .+|..+..+.+|..++..|.+++++ .+++++.
T Consensus        84 ~v~~l~~~~~~~i~~L~~~Gv~f~~~~~g~~~~~~~g~~s~~~~~~~~~~~~~~~d~~G~~i~~~L~~~~~~-~~v~~~~  162 (330)
T d1neka2          84 AIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLK-NHTTIFS  162 (330)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCCCBCSCBTTBCCCSSBCEEECTTSSSEEEECCTTCHHHHHHHHHHHHHHH-TTCEEEC
T ss_pred             HHHHHHHHhHHHHHHHhhccccccccCCCceehhccCcccccccCcccccccccCCccHHHHHHHHHHHHHh-cCCeEEE
Confidence            9999999999999999999999999999988776666665       3567778889999999999999987 4999999


Q ss_pred             ceEEEEEEecCCCCCCeEEEEEEEecCCCeEEEEEcCeEEECCCcccccCCCCCCCCCCcchHHHHHHHcCCeecCcccc
Q 006387          235 HHFAIDLLTTLDGPDAVCHGVDTLNVETQEVVRFISKVTLLASGGAGHIYPSTTNPLVATGDGMAMAHRAQAVISNMEFV  314 (647)
Q Consensus       235 ~~~v~~l~~~~~g~~~~v~Gv~~~~~~~g~~~~i~Ak~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~  314 (647)
                      ++.++++++++++   +++|+.+.+..+|+.+.|.|+.|||||||++++|..++||+.+||||++|++++|+.+.||++ 
T Consensus       163 ~~~~~~l~~~~~~---~~~g~~~~~~~~g~~~~~~a~~vIlAtGG~~~ly~~ttn~~~~tGdG~~~a~~aGa~l~d~~~-  238 (330)
T d1neka2         163 EWYALDLVKNQDG---AVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMMG-  238 (330)
T ss_dssp             SEEEEEEEECTTS---CEEEEEEEETTTCCEEEEEESCEEECCCCCGGGSSSBSSCTTCSCHHHHHHHTTTCCEESECC-
T ss_pred             EEEEEEeeeeccc---cceeeeeEEccCCcEEEEeccEEEEcCCCccccccCcCCCCccEeHHHHHHHHcCCCcccccc-
Confidence            9999999987666   788999889899999999999999999999999999999999999999999999999999874 


Q ss_pred             ccccccccCCCCCCCCCCCCCccceeeecccCCCceEEeCCCCccccccccccccCchhHHHHHHHHHHHhcCCCeEEEe
Q 006387          315 QFHPTALADEGLPIKPKKTRENSFLITEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRNEKYVLLD  394 (647)
Q Consensus       315 q~~p~~~~~~g~~~~p~~~~~~~~l~~e~~~~~g~~~vn~~G~rf~~~~~~~~~l~~rd~~~~~i~~~~~~~~~~~v~ld  394 (647)
                       ++|..+..                        .+.+++..|++                                    
T Consensus       239 -~~~~~~~~------------------------~~~~~~~~g~~------------------------------------  257 (330)
T d1neka2         239 -GIPTKVTG------------------------QALTVNEKGED------------------------------------  257 (330)
T ss_dssp             -BEEBCTTC------------------------EEEEECSSSCE------------------------------------
T ss_pred             -cccccccc------------------------ceeecccCCCc------------------------------------
Confidence             44432210                        01222222221                                    


Q ss_pred             cCCCChhHHHhhChhHHHHHHHcCCCCCCCCeeeeeeeceecCceEECCCCCcccCceeecccccCCCCCCCCccchhhh
Q 006387          395 ISHKPTEKILSHFPNIAAECLKYGLDITSQPIPVVPAAHYMCGGVRAGLQGETNVRGLYVAGEVACTGLHGANRLASNSL  474 (647)
Q Consensus       395 ~~~~~~~~l~~~~~~~~~~~~~~G~d~~~~~i~v~p~~~~~~GGi~vD~~~~T~ipGLyAaGe~a~~g~~Ga~rl~g~sl  474 (647)
                                                                          +.+|||||+||++|.|+||+|||+||+|
T Consensus       258 ----------------------------------------------------~v~~gl~a~Ge~a~~g~HganrL~~nsl  285 (330)
T d1neka2         258 ----------------------------------------------------VVVPGLFAVGEIACVSVHGANRLGGNSL  285 (330)
T ss_dssp             ----------------------------------------------------EEEEEEEECSSSEECSSSTTSCCTTHHH
T ss_pred             ----------------------------------------------------eecccccccCcccccccccccccccccH
Confidence                                                                1288999999999889999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhc
Q 006387          475 LEALVFARRAVQPSIDHKKS  494 (647)
Q Consensus       475 ~~a~v~G~~Ag~~a~~~~~~  494 (647)
                      .+++|||++||++|+++++.
T Consensus       286 ~~~~v~g~~ag~~~~~~~~~  305 (330)
T d1neka2         286 LDLVVFGRAAGLHLQESIAE  305 (330)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhc
Confidence            99999999999999988754
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra3 d.168.1.1 (A:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure