Citrus Sinensis ID: 006407
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 646 | ||||||
| 224073082 | 647 | predicted protein [Populus trichocarpa] | 0.996 | 0.995 | 0.782 | 0.0 | |
| 224057202 | 647 | predicted protein [Populus trichocarpa] | 0.996 | 0.995 | 0.768 | 0.0 | |
| 255575774 | 694 | Zuotin, putative [Ricinus communis] gi|2 | 0.995 | 0.926 | 0.777 | 0.0 | |
| 449457039 | 647 | PREDICTED: dnaJ homolog subfamily C memb | 0.993 | 0.992 | 0.759 | 0.0 | |
| 359472800 | 711 | PREDICTED: dnaJ homolog subfamily C memb | 0.996 | 0.905 | 0.767 | 0.0 | |
| 356525975 | 637 | PREDICTED: dnaJ homolog subfamily C memb | 0.978 | 0.992 | 0.758 | 0.0 | |
| 147802497 | 645 | hypothetical protein VITISV_040643 [Viti | 0.989 | 0.990 | 0.770 | 0.0 | |
| 356543413 | 636 | PREDICTED: dnaJ homolog subfamily C memb | 0.976 | 0.992 | 0.761 | 0.0 | |
| 357511343 | 653 | DnaJ homolog subfamily C member [Medicag | 0.986 | 0.975 | 0.713 | 0.0 | |
| 222051766 | 650 | gonidia forming protein GlsA [Alstroemer | 0.979 | 0.973 | 0.703 | 0.0 |
| >gi|224073082|ref|XP_002303963.1| predicted protein [Populus trichocarpa] gi|222841395|gb|EEE78942.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 956 bits (2471), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 505/645 (78%), Positives = 567/645 (87%), Gaps = 1/645 (0%)
Query: 1 MVVHASFRLISYSDELVDGQPIYVSSNCLPLKASKYEPAGHSFHAAALKLLGCEED-VEV 59
M + S RLISYS ELVDGQP++VSSN LP+KA K+EPAGH+FH AALKLLG EE+ +
Sbjct: 1 MAIQTSLRLISYSQELVDGQPLHVSSNGLPIKALKFEPAGHAFHTAALKLLGWEEEGTKT 60
Query: 60 DDQKVSNDKEQTCFPSYESYSSKGKKKSGEGSNQQDHYALLGLSHLRYLATEDQIRKSYR 119
+DQKVSNDK+Q+ PS ESYS+KGKKKSG G QQDHYALLGL HLRYLATE+QIRKSYR
Sbjct: 61 EDQKVSNDKQQSYMPSSESYSTKGKKKSGSGDTQQDHYALLGLGHLRYLATEEQIRKSYR 120
Query: 120 ETALKYHPDKQAALLFAEETEAAKQAKKDEIETHFKAVQEAYEVLIDPVKRRIYDSTDEF 179
E ALKYHPDKQAA+L AEE+EAAKQAKKDEIE+HFKA+QEAYE LIDPVKRRIYDSTDEF
Sbjct: 121 EVALKYHPDKQAAILLAEESEAAKQAKKDEIESHFKAIQEAYEALIDPVKRRIYDSTDEF 180
Query: 180 DDAIPADCAPQDFYKVFGPAFTRNGRWSANQLVPSLGDENTPLKEVDNFYNFWYSFKSWR 239
DD IP DCAPQDF+KVFGPAF RNGRWS NQ VPSLGDE T LKEVD+FYNFWYSFKSWR
Sbjct: 181 DDEIPTDCAPQDFFKVFGPAFMRNGRWSVNQTVPSLGDEKTSLKEVDSFYNFWYSFKSWR 240
Query: 240 EFPHADEFDLEQAESRDHKRWMERQNAKLTEKARKEEYARIRTLVDNAYKRDPRILKRKE 299
EFPHADEFDLE+AESRDHKRWMERQNAKL+EKARKE+YARIRTLVD+AYKRDPRIL+RKE
Sbjct: 241 EFPHADEFDLEEAESRDHKRWMERQNAKLSEKARKEDYARIRTLVDSAYKRDPRILRRKE 300
Query: 300 AEKAEKQKKKEAKYLAKKLQEEEAARAAEEERRRKVEEEKRVAEVALQQKKVKEKEKKLL 359
EKAEKQ+KKEAKYLAK+LQEEEAARAAEEE+R+K EEEKRVAE ALQQKK+KEKEKKLL
Sbjct: 301 EEKAEKQRKKEAKYLAKRLQEEEAARAAEEEKRQKEEEEKRVAEAALQQKKLKEKEKKLL 360
Query: 360 RKERTRLRTLSASVTSQHLLDVSTEDVESLCMSFDMEQLRNLCDKMEKSEGLEQAKLIRN 419
RKER+RLRTLS SV SQ LL++S DVE+LCMS D+EQLR+LCD++E E LEQAK++R+
Sbjct: 361 RKERSRLRTLSGSVLSQCLLNLSEADVENLCMSLDIEQLRSLCDRIEGKEVLEQAKVLRD 420
Query: 420 AVGHADESEAKKQDEKKNVQQNGSVETNGSTLLKSFEKKEKPWSKEEIELLRKGMQKYPK 479
A G +S + KQ+EKK QQNGS+ +NGS+ L S KKEKPW +EEIELLRKG QKYPK
Sbjct: 421 ACGCDHDSGSSKQEEKKISQQNGSLNSNGSSPLSSSGKKEKPWGREEIELLRKGTQKYPK 480
Query: 480 GTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDGAKAFDSFLEKRKPAQSIASPLTTR 539
GTSRRWEVIS+YIGTGRSVEEILKATKTVLLQKPD AKAF+SFLEKRKPAQSI SPL+TR
Sbjct: 481 GTSRRWEVISDYIGTGRSVEEILKATKTVLLQKPDSAKAFNSFLEKRKPAQSIESPLSTR 540
Query: 540 EEVVGASTPQVVQNSGARTDSSEESSSSTSQKPADVTAANGVSSSSDQDAWSAVQERALV 599
EE+ GAST Q +++S A+ E SS + QK DV ANGVSSS+DQD WSAVQERALV
Sbjct: 541 EEIEGASTVQALESSAAKVAQEESSSDTDKQKTDDVVTANGVSSSADQDVWSAVQERALV 600
Query: 600 QALKTFPKETSQRWERVATAVPGKTVIQCKKKFASLKENFRSKKS 644
QALKTFPKETSQRWERV+ AVPGKT+ QCKKKFA LKE+FR+KK+
Sbjct: 601 QALKTFPKETSQRWERVSAAVPGKTINQCKKKFALLKESFRNKKN 645
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224057202|ref|XP_002299170.1| predicted protein [Populus trichocarpa] gi|222846428|gb|EEE83975.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255575774|ref|XP_002528786.1| Zuotin, putative [Ricinus communis] gi|223531789|gb|EEF33608.1| Zuotin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449457039|ref|XP_004146256.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Cucumis sativus] gi|449495541|ref|XP_004159872.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359472800|ref|XP_002274720.2| PREDICTED: dnaJ homolog subfamily C member 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525975|ref|XP_003531595.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147802497|emb|CAN64160.1| hypothetical protein VITISV_040643 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356543413|ref|XP_003540155.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511343|ref|XP_003625960.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|355500975|gb|AES82178.1| DnaJ homolog subfamily C member [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|222051766|dbj|BAH15356.1| gonidia forming protein GlsA [Alstroemeria aurea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 646 | ||||||
| TAIR|locus:2152835 | 663 | AT5G06110 [Arabidopsis thalian | 0.447 | 0.435 | 0.594 | 2.8e-174 | |
| UNIPROTKB|Q6P2Y3 | 620 | dnajc2 "DnaJ homolog subfamily | 0.297 | 0.309 | 0.467 | 2.4e-75 | |
| ZFIN|ZDB-GENE-040426-1912 | 618 | dnajc2 "DnaJ (Hsp40) homolog, | 0.297 | 0.310 | 0.463 | 1.2e-69 | |
| DICTYBASE|DDB_G0278179 | 634 | DDB_G0278179 "DNAJ heat shock | 0.287 | 0.293 | 0.46 | 6.1e-64 | |
| UNIPROTKB|Q1RMH9 | 621 | DNAJC2 "DnaJ homolog subfamily | 0.297 | 0.309 | 0.472 | 1.3e-63 | |
| UNIPROTKB|F1P3V8 | 621 | DNAJC2 "Uncharacterized protei | 0.297 | 0.309 | 0.467 | 1.3e-63 | |
| UNIPROTKB|E2RS54 | 627 | DNAJC2 "Uncharacterized protei | 0.297 | 0.306 | 0.472 | 6.9e-63 | |
| UNIPROTKB|F1SB54 | 621 | DNAJC2 "Uncharacterized protei | 0.297 | 0.309 | 0.472 | 8.8e-63 | |
| WB|WBGene00001029 | 589 | dnj-11 [Caenorhabditis elegans | 0.294 | 0.322 | 0.443 | 2.3e-62 | |
| UNIPROTKB|Q4R8H2 | 621 | DNAJC2 "DnaJ homolog subfamily | 0.297 | 0.309 | 0.472 | 2.9e-62 |
| TAIR|locus:2152835 AT5G06110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 921 (329.3 bits), Expect = 2.8e-174, Sum P(2) = 2.8e-174
Identities = 176/296 (59%), Positives = 212/296 (71%)
Query: 3 VHASFRLISYSDELVDGQPIYVSSNCLPLKASKYEPAGHSFHAAALKLLGCEEDV----E 58
++++ +L++YS EL DGQ +Y SSNC P+KA EPAGH+FH+AALKL GC ++ E
Sbjct: 6 INSAIKLLTYSSELKDGQALYASSNCHPVKALNREPAGHAFHSAALKLRGCAKEATSKNE 65
Query: 59 VDDQKVSNDKEQTCFPXXXXXXXXXXXXXXXXXNQQDHYALLGLSHLRYLATEDQIRKSY 118
D+KV +K+ P Q DHYALLGL +LRYLAT+DQIRKSY
Sbjct: 66 DTDKKVPKEKDGEYIPSYDSHNIKGKKKSGKL--QHDHYALLGLGNLRYLATDDQIRKSY 123
Query: 119 RETALKYHPDKQXXXXXXXXXXXXXXXXXXXIETHFKAVQEAYEVLIDPVKRRIYDSTDE 178
R+ ALK+HPDK IE+HFK +QEAYEVL+D KRRI+DSTDE
Sbjct: 124 RDAALKHHPDKLATLLLLEETEEAKQAKKDEIESHFKLIQEAYEVLMDSTKRRIFDSTDE 183
Query: 179 FDDAIPADCAPQDFYKVFGPAFTRNGRWSANQLVPSLGDENTPLKEVDNFYNFWYSFKSW 238
FDD +P DCAPQDF+KVFGPAF RN RWS N +P LGDENTPLKEVD FY+ WY+FKSW
Sbjct: 184 FDDKVPTDCAPQDFFKVFGPAFKRNARWS-NSPLPDLGDENTPLKEVDRFYSTWYTFKSW 242
Query: 239 REFPHADEFDLEQAESRDHKRWMERQNAKLTEKARKEEYARIRTLVDNAYKRDPRI 294
REFP +E D+EQAESR+ KRWMER+NA+ T+KARKEEYARIRTLVDNAYK+D RI
Sbjct: 243 REFPEEEEHDIEQAESREEKRWMERENARKTQKARKEEYARIRTLVDNAYKKDIRI 298
|
|
| UNIPROTKB|Q6P2Y3 dnajc2 "DnaJ homolog subfamily C member 2" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1912 dnajc2 "DnaJ (Hsp40) homolog, subfamily C, member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0278179 DDB_G0278179 "DNAJ heat shock N-terminal domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1RMH9 DNAJC2 "DnaJ homolog subfamily C member 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3V8 DNAJC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RS54 DNAJC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SB54 DNAJC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001029 dnj-11 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R8H2 DNAJC2 "DnaJ homolog subfamily C member 2" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00031749 | hypothetical protein (648 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 646 | |||
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 2e-53 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-16 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 6e-16 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-14 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 4e-14 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 6e-13 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 2e-12 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 3e-12 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 3e-12 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 6e-12 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 7e-12 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-11 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 5e-11 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 7e-11 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 7e-11 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-10 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 3e-10 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 5e-10 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-09 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 5e-09 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 1e-08 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 1e-08 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-08 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 5e-08 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-07 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-07 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 2e-06 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-06 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 6e-06 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 1e-05 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 1e-05 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-05 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 5e-05 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 8e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 9e-05 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-04 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 1e-04 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-04 | |
| PRK03578 | 176 | PRK03578, hscB, co-chaperone HscB; Provisional | 3e-04 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 4e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 0.001 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 |
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 187 bits (476), Expect = 2e-53
Identities = 105/277 (37%), Positives = 146/277 (52%), Gaps = 15/277 (5%)
Query: 93 QQDHYALLGLSHLRYLATEDQIRKSYRETALKYHPDKQAALLFAEETEAAKQAKKDEIET 152
+ D YALLGLS R A QI K++++ KYHPDK AA E
Sbjct: 42 KVDLYALLGLSKYRTKAIPPQILKAHKKKVYKYHPDKTAAGGNKGCDEF----------- 90
Query: 153 HFKAVQEAYEVLIDPVKRRIYDSTDEFDDAIPAD--CAPQDFYKVFGPAFTRNGRWSANQ 210
FK +Q+A EVL D R YDS D FD +P P +F++V+ P F R R+S Q
Sbjct: 91 -FKLIQKAREVLGDRKLRLQYDSND-FDADVPPPRIYTPDEFFEVWEPVFEREARFSKKQ 148
Query: 211 LVPSLGDENTPLKEVDNFYNFWYSFKSWREFPHADEFDLEQAESRDHKRWMERQNAKLTE 270
VPSLG ++ LKEV+ FY FW +F SWR F DE + E RD KR+ E +N +
Sbjct: 149 PVPSLGPSDSSLKEVEEFYEFWSNFDSWRTFEPLDEDYPDDMEERDRKRYSEAKNREKRA 208
Query: 271 KARKEEYARIRTLVDNAYKRDPRILKRKEAEKAEKQKKKEAKYLAKKLQEEEAARAAEEE 330
K + ++ AR++ LV A KRDPRI KE EK K+ +K + +L+ A + E
Sbjct: 209 KLKNQDNARLKRLVQIAKKRDPRIKSFKEQEKEMKKIRKWEREAGARLKALAALKGKAEA 268
Query: 331 RRRKVEEEKRVAEVALQQKKVKEKEKKLLRKERTRLR 367
+ + E + +A +KK KE KK L+ E+ ++
Sbjct: 269 KNKAEIEAEALASATAVKKKAKEVMKKALKMEKKAIK 305
|
Length = 379 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 646 | |||
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 100.0 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.87 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.8 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.74 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.73 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.68 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.67 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.67 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.66 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.65 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.65 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.64 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.63 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.62 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.61 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.61 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.6 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.6 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.6 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.6 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.59 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.58 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.58 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.58 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.57 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.57 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.56 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.56 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.56 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.56 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.53 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.52 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.47 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.45 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.41 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.38 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.38 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.38 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.37 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.35 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.3 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.29 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.28 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.26 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.23 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.16 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.1 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.05 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.0 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 98.98 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.97 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.96 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 98.95 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 98.89 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.86 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.84 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 98.82 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.72 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.66 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.66 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.58 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.58 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 98.48 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.34 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.31 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.21 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.14 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.98 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 97.91 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 97.86 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.54 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.35 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.34 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 96.97 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 96.84 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.81 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.74 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.61 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 96.57 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 96.43 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.24 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 96.16 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 95.81 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 95.35 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.24 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.16 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 95.15 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.13 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.1 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.06 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 94.62 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 94.53 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 94.5 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 93.2 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 93.06 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 93.04 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 93.02 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 92.9 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 92.07 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 91.58 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 91.42 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 91.17 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 91.08 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 91.04 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 90.75 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 88.7 | |
| PRK00247 | 429 | putative inner membrane protein translocase compon | 88.55 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 88.43 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 87.88 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 87.57 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 85.76 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 85.69 | |
| COG3064 | 387 | TolA Membrane protein involved in colicin uptake [ | 84.99 | |
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 84.81 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 84.4 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 83.78 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 83.68 | |
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 82.71 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 80.43 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 80.21 |
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-57 Score=451.62 Aligned_cols=304 Identities=36% Similarity=0.515 Sum_probs=271.9
Q ss_pred CCccccccccccccccCCCCCHHHHHHHHHHhhhhcCCCchhhhhhhhhHHHHHhhchHHHHHHHHHHHHHHHHhcchhh
Q 006407 90 GSNQQDHYALLGLSHLRYLATEDQIRKSYRETALKYHPDKQAALLFAEETEAAKQAKKDEIETHFKAVQEAYEVLIDPVK 169 (646)
Q Consensus 90 ~~k~~d~Y~vLGl~~~r~~At~~eIKkAYrklalk~HPDK~~~~~~~e~~e~~~~~~~~~~~~~F~~I~~AYeiLsDp~k 169 (646)
+|+.+|+|.+|||+.+|+.+++.+|.+++++.+++||||+..+.| ...++..|++||+||+||+|+.+
T Consensus 39 ~Wk~~DlYa~lgLskyR~ka~~~qi~kah~kkv~kyHPDk~aa~g------------~~~~d~fFk~iqkA~evL~D~~~ 106 (379)
T COG5269 39 NWKKVDLYALLGLSKYRTKAIPPQILKAHKKKVYKYHPDKTAAGG------------NKGCDEFFKLIQKAREVLGDRKL 106 (379)
T ss_pred hhhhhhHHHHhchHhhhcCCCcHHHHHHHHHHHHHhCccchhccC------------CCCcHHHHHHHHHHHHHhccHHH
Confidence 899999999999999999999999999999999999999996533 34568999999999999999999
Q ss_pred hhhhcccCCCCCCCCC-CCCCCchHHhhhhhhccCCCCccCccCCCCCCCCCChHHHHhhhhHHhcccccccCCCccccc
Q 006407 170 RRIYDSTDEFDDAIPA-DCAPQDFYKVFGPAFTRNGRWSANQLVPSLGDENTPLKEVDNFYNFWYSFKSWREFPHADEFD 248 (646)
Q Consensus 170 R~~YDs~~~~~~~~p~-~~~~~~Ff~~f~~~F~~~~r~s~~~~~P~lG~~~s~~e~v~~FY~fw~~F~SwR~f~~~de~~ 248 (646)
|.+|||++...+-.|. ...+.+||++|+|+|.+++|||..+|||+||..+++..+|+.||.||+||+|||+|.++|+.-
T Consensus 107 R~qyDS~df~advppp~~~t~~~Ffe~w~pvFe~earFSkKqPvPsLg~~dss~keVe~FY~FW~nFdSWRtFE~lded~ 186 (379)
T COG5269 107 RLQYDSNDFDADVPPPRIYTPDEFFEVWEPVFEREARFSKKQPVPSLGPSDSSLKEVEEFYEFWSNFDSWRTFEPLDEDY 186 (379)
T ss_pred HhhccccccccCCCCccCCCchhHHHHHHHHHHhhhhccccCCCCCCCCchhHHHHHHHHHHHHHhccccccccchhhhc
Confidence 9999998654443333 346899999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhccHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhhcChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 006407 249 LEQAESRDHKRWMERQNAKLTEKARKEEYARIRTLVDNAYKRDPRILKRKEAEKAEKQKKKEAKYLAKKLQEEEAARAAE 328 (646)
Q Consensus 249 ~e~~e~R~~rR~~Ek~N~k~r~k~kke~~~rir~LV~~a~~~DpRik~~keeek~~k~~~k~~k~~~~r~~~ee~~~~~e 328 (646)
.++.++|+++|+.|+.|+..|.+.+..++.||+.||+.|.++||||+-|+++++..+...++++++..+.+...+....+
T Consensus 187 pdd~e~rD~kry~e~KNr~~r~k~K~~DnaRl~~LV~~A~~~DPRIK~fkEqeK~~k~~rkWereagar~~a~aa~k~ka 266 (379)
T COG5269 187 PDDMEERDRKRYSEAKNREKRAKLKNQDNARLKRLVQIAKKRDPRIKSFKEQEKEMKKIRKWEREAGARLKALAALKGKA 266 (379)
T ss_pred CcchhhhhhHHHHHhhhHHHHHhhhchhHHHHHHHHHHHHhcCcchhhHHHHHHHHHHHhccchhhhhhHHHHHHHhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999888887777666666
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccccccCC------ChhhHHHhhcCCCHHHHHHHH
Q 006407 329 EERRRKVEEEKRVAEVALQQKKVKEKEKKLLRKERTRLRTLSASVTSQHLLDV------STEDVESLCMSFDMEQLRNLC 402 (646)
Q Consensus 329 eer~~ke~ee~~~~e~~~~~KK~ke~~Kk~lkKekk~lR~~~~~~~~~~~~~~------~~~dve~lc~~l~~e~L~~l~ 402 (646)
+++.+.+.+.++.+-.....|++||..+++++.+++.+|+..++ .+||+. .++||++|+.+|..++|..|.
T Consensus 267 e~k~kae~ea~a~asa~a~kkkaKE~~kka~k~~Kk~ikna~kd---~~yf~d~~~a~~id~~v~li~~~l~d~el~~~a 343 (379)
T COG5269 267 EAKNKAEIEAEALASATAVKKKAKEVMKKALKMEKKAIKNAAKD---ADYFGDADKAEHIDEDVDLIMDKLGDEELGQLA 343 (379)
T ss_pred HHHhHHHHHHHHhhhhHHHHHhHHHHHHHHHHHHHHHHHhhhhh---hccccCCchhhhcchhhhHHHHhcCcHHHHHHH
Confidence 66666666666655566677899999999999999999998884 455552 248999999999999999999
Q ss_pred HHhhcc
Q 006407 403 DKMEKS 408 (646)
Q Consensus 403 ~~l~~~ 408 (646)
..+.+.
T Consensus 344 ~~i~a~ 349 (379)
T COG5269 344 ADIKAE 349 (379)
T ss_pred HHhhhh
Confidence 888654
|
|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PRK00247 putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 646 | ||||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-07 | ||
| 2m2e_A | 73 | Solution Nmr Structure Of The Sant Domain Of Human | 2e-07 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-07 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-07 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 3e-07 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 2e-06 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-05 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 1e-05 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 2e-05 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-05 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 2e-05 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 4e-05 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 7e-05 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 5e-04 |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
|
| >pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 646 | |||
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 1e-18 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 2e-16 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-16 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 7e-16 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 8e-16 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 2e-05 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 9e-16 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 9e-16 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 1e-15 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 4e-15 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 4e-15 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 1e-14 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-14 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-14 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-14 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 2e-14 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 3e-14 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 2e-05 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 3e-14 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-14 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-14 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 4e-14 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 2e-07 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 7e-14 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 1e-13 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 2e-13 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-13 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 2e-13 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 4e-09 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-12 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 5e-12 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-11 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 7e-11 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 1e-10 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 3e-08 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 7e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-04 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 7e-07 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 8e-05 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 6e-06 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 9e-06 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 5e-04 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 1e-05 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 2e-05 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 7e-05 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 9e-05 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 8e-05 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 8e-05 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 1e-04 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 2e-04 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 7e-04 |
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
Score = 82.2 bits (203), Expect = 1e-18
Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 11/89 (12%)
Query: 87 SGEGSNQQDHYALLGLSHLRYLATEDQIRKSYRETALKYHPDKQAALLFAEETEAAKQAK 146
+ E ++D Y++LG A +++ Y++ L YHPDKQ+ + A E
Sbjct: 3 AVEQMPKKDWYSILGADPS---ANISDLKQKYQKLILMYHPDKQSTDVPAGTVEEC---- 55
Query: 147 KDEIETHFKAVQEAYEVLIDPVKRRIYDS 175
F + +A+++L + +R YD
Sbjct: 56 ----VQKFIEIDQAWKILGNEETKREYDL 80
|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 646 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.84 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.83 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.82 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.81 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.78 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.75 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.71 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.71 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.71 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.71 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.7 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.69 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.69 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.69 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.68 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.68 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.67 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.67 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.67 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.66 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.65 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.65 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.64 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.63 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.6 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.6 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.59 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.59 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.57 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.57 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.56 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.54 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.53 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.53 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.53 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.51 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.5 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.5 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.5 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.5 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.49 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.46 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.39 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.38 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.32 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.31 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.29 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.28 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.23 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.18 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.14 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.13 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.11 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.1 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.06 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.03 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.02 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.01 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.01 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 98.99 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 98.95 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 98.93 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 98.9 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 98.9 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.89 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 98.85 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.85 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.84 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 98.84 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.83 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 98.81 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.28 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.78 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 98.78 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.77 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 98.69 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 98.69 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.68 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.68 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 98.65 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.59 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.56 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.54 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.5 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.44 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.43 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.37 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.36 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.35 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.32 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.3 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.26 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.24 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.24 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 97.54 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.22 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.21 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.18 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.17 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 98.13 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.11 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.1 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.05 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.98 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 97.95 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 97.9 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.89 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 97.02 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 97.42 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 97.37 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 97.21 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.16 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.12 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 96.86 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.84 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 96.82 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.63 | |
| 2lwx_A | 108 | Zuotin; J-protein, molecular chaperone, pleiotropi | 96.26 | |
| 4gmq_A | 103 | Putative ribosome associated protein; ribosome bin | 96.14 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 95.91 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 95.91 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 95.57 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 95.5 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 95.44 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 95.4 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 94.67 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 93.66 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 93.54 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 92.6 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 91.58 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 89.03 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.84 E-value=1e-20 Score=169.24 Aligned_cols=101 Identities=14% Similarity=0.303 Sum_probs=88.2
Q ss_pred CCCCHHHHHHHHHHHHhCCCCCCcchhHHHhHhcCCCCHHHHHHHHHHHhhcCCCchhhhHHHHhhcCCcCccCCCCcch
Q 006407 460 KPWSKEEIELLRKGMQKYPKGTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDGAKAFDSFLEKRKPAQSIASPLTTR 539 (646)
Q Consensus 460 ~~Wt~eE~~~L~kav~~~p~gt~~RW~~IA~~~~~~Rt~ke~~~~~k~~l~qk~~~~ka~~~f~~~~k~~~~i~~~~~~r 539 (646)
++||.||+.+|.++|..|+. .+|..||.+|| +||++||+.||.++|
T Consensus 2 ~~Wt~eED~~L~~~v~~~g~---~~W~~Ia~~~~-~Rt~~qcr~Rw~~~L------------------------------ 47 (107)
T 2k9n_A 2 VKFTEEEDLKLQQLVMRYGA---KDWIRISQLMI-TRNPRQCRERWNNYI------------------------------ 47 (107)
T ss_dssp CSSCHHHHHHHHHHHHHHCS---SCHHHHHHHTT-TSCHHHHHHHHHHHS------------------------------
T ss_pred CCCCHHHHHHHHHHHHHHCC---CCHHHHhhhcC-CCCHHHHHHHHHHHH------------------------------
Confidence 57999999999999999954 37999999998 699999999999876
Q ss_pred hhhccCCCccccccCCCCCCCCccccCCCCCCCCcccccCCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCChhHHHHHhh
Q 006407 540 EEVVGASTPQVVQNSGARTDSSEESSSSTSQKPADVTAANGVSSSSDQDAWSAVQERALVQALKTFPKETSQRWERVATA 619 (646)
Q Consensus 540 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~WT~eE~~~Le~al~~~p~~~~~rW~~IA~~ 619 (646)
.|.....+||++||.+|..++..|| .+|..||..
T Consensus 48 ------------------------------------------~p~i~~~~WT~eEd~~L~~~~~~~G----~~W~~Ia~~ 81 (107)
T 2k9n_A 48 ------------------------------------------NPALRTDPWSPEEDMLLDQKYAEYG----PKWNKISKF 81 (107)
T ss_dssp ------------------------------------------SSCCTTCCCCHHHHHHHHHHHHHTC----SCHHHHHHH
T ss_pred ------------------------------------------cccccccccCHHHHHHHHHHHHHhC----cCHHHHHHH
Confidence 1122335899999999999999997 479999999
Q ss_pred CCCCCHHHHHHHHHHHHHHHh
Q 006407 620 VPGKTVIQCKKKFASLKENFR 640 (646)
Q Consensus 620 Vpgrt~~~c~~Ryk~l~~~vk 640 (646)
|||||..+|++||..|.....
T Consensus 82 l~gRt~~~~k~rw~~l~r~~~ 102 (107)
T 2k9n_A 82 LKNRSDNNIRNRWMMIARHRA 102 (107)
T ss_dssp HSSSCHHHHHHHHHHHHHHHH
T ss_pred CCCCCHHHHHHHHHHHHhhHH
Confidence 999999999999998876543
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lwx_A Zuotin; J-protein, molecular chaperone, pleiotropic drug resistance, chaperone; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gmq_A Putative ribosome associated protein; ribosome binding, CO-translational chaperone, ribosome-bindi protein; 1.30A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 646 | ||||
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 4e-12 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-11 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-10 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 2e-10 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 5e-10 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-08 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 5e-08 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 6e-08 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 6e-08 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 4e-07 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 3e-05 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 3e-05 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 9e-05 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 2e-04 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 0.002 |
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 60.5 bits (146), Expect = 4e-12
Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 11/81 (13%)
Query: 94 QDHYALLGLSHLRYLATEDQIRKSYRETALKYHPDKQAALLFAEETEAAKQAKKDEIETH 153
+D Y++LG A +++ Y++ L YHPDKQ+A + A +E
Sbjct: 16 KDWYSILGADPS---ANMSDLKQKYQKLILLYHPDKQSADVPAGT--------MEECMQK 64
Query: 154 FKAVQEAYEVLIDPVKRRIYD 174
F + +A+++L + ++ YD
Sbjct: 65 FIEIDQAWKILGNEETKKKYD 85
|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 646 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.77 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.74 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.69 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.6 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.57 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.55 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.55 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.53 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.48 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.45 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.42 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.24 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.18 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.07 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.04 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.97 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.91 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.86 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 98.84 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.82 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.82 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.82 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 98.81 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.79 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.73 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.71 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.7 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.67 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.65 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.61 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.5 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.41 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 98.4 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.36 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.32 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.13 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.1 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 97.94 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 97.76 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 97.73 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.13 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 95.26 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 93.3 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 89.2 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 86.96 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.77 E-value=9.4e-20 Score=150.80 Aligned_cols=69 Identities=48% Similarity=0.795 Sum_probs=62.9
Q ss_pred ccccccccccccCCCCCHHHHHHHHHHhhhhcCCCchhhhhhhhhHHHHHhhchHHHHHHHHHHHHHHHHhcchhhhhhh
Q 006407 94 QDHYALLGLSHLRYLATEDQIRKSYRETALKYHPDKQAALLFAEETEAAKQAKKDEIETHFKAVQEAYEVLIDPVKRRIY 173 (646)
Q Consensus 94 ~d~Y~vLGl~~~r~~At~~eIKkAYrklalk~HPDK~~~~~~~e~~e~~~~~~~~~~~~~F~~I~~AYeiLsDp~kR~~Y 173 (646)
+|||+||||++ +||.++||+|||+++++||||++++ ...+...|..|++||+||+||.+|..|
T Consensus 3 ~dyY~vLgv~~---~As~~eIk~aYr~l~~~~HPDk~~~--------------~~~~~~~f~~i~~Ay~vL~d~~~R~~Y 65 (75)
T d1xbla_ 3 QDYYEILGVSK---TAEEREIRKAYKRLAMKYHPDRNQG--------------DKEAEAKFKEIKEAYEVLTDSQKRAAY 65 (75)
T ss_dssp CCTTTTTCCSS---SCCHHHHHHHHHHHHHHTCCTTCTT--------------TCHHHHHHHHHHHHHHHTTSSHHHHHH
T ss_pred CCHHHHcCCCC---CcCHHHHHHHHHHHHhhhhhhccCC--------------ChHHHHHHHHHHHHHHhcCCHHHHHHH
Confidence 69999999999 9999999999999999999999885 234577899999999999999999999
Q ss_pred cccCCC
Q 006407 174 DSTDEF 179 (646)
Q Consensus 174 Ds~~~~ 179 (646)
|.+|..
T Consensus 66 D~~g~~ 71 (75)
T d1xbla_ 66 DQYGHA 71 (75)
T ss_dssp HHHTTS
T ss_pred HHhCcc
Confidence 998753
|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|