Citrus Sinensis ID: 006428


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-----
MLKPQVHQSHQSLKPLVPLSKPFLRGNFHAFRALQSSSSIKNIPKIRIGISPSVNIKAITTFTQKSTQVKAFVTIKPSVGGLVSGFVDDVKDMFGKSLLLELVSAELDPKTGAEKPTIKGFAHRAGEDKDGHIIYESKFEVPPSFGEVGAILVENEHHKEMYLNDIVLDGPRNGPVNITCGSWVQSKHVNKQKRIFFTNKSYLPSQTPNGLTRLRAEELLNLRGDGQGERKTHDRIYDYDVYNDLGVPDFCSELARPVLGGKEHPYPRRCRTGRPPCETDPASESRTLINYVPRDEAFSEIKQLQFSAKTLYSVLHGLVPSLETAIIDTDLGFPYFTTIDKLFNEGVNVPMPETFKEKALWRTILPRLVKGIEDTGKEVLRFETPETMDRDKFFWFRDEEFGRQTLAGLNPYSIRLVTEWPLRSTLDPEIYGPPESAITKELIEKEIGGIMTVEEAIKQKKLFILDYHDLLLPYVEKVRELKGTTLYGSRTLFFSYPSGTLRPLAIELTRPPMDGKPQWKQVFTPSWHSTECWLWRLAKAHVLAHDSGYHQLVSHWLRTHCCTEPYIIATNRQLSAMHPINRLLQPHFRYTMEINALAREALVNAGGIIESTFSPGKYSMELSSVAYDKHWRFDHEALPKDLISR
cccccccccccccccccccccccccccccccccccccccccccccEEEEcccccCEEEEEEEEEEEEEEEEEEEEEccccccccccccHHHHHccccEEEEEEEEECcccccccccccccccccccccccccEEEEEEEEEccccccEEEEEEEEcccccEEEEEEEECcccccCEEEEEcccECccccccccEEEECccccccccccHHHHHHHHHHHHHHHcccccccccccCEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccEEccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccCEEEEEEEEEEEcccccEEcEEEEEccccccccccccEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHcccccccccccccccccHHHHHHcHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccccccccccHHHHcc
********************KPFLRGN**********SSIKNIPKIRIGISPSVNIKAITTFTQKSTQVKAFVTIKPSVGGLVSGFVDDVKDMFGKSLLLELVSAEL*************F*HRAGEDKDGHIIYESKFEVPPSFGEVGAILVENEHHKEMYLNDIVLDGPRNGPVNITCGSWVQSKHVNKQKRIFFTNKSYLPSQTPNGLTRLRAEELLN**G**QGERKTHDRIYDYDVYNDLGVPDFCSELARPVLGGKEHPYPRR*RTGR***ETD***ESRTLINYVPRDEAFSEIKQLQFSAKTLYSVLHGLVPSLETAIIDTDLGFPYFTTIDKLFNEGVNVPMPETFKEKALWRTILPRLVKGIEDTGKEVLRFETPETMDRDKFFWFRDEEFGRQTLAGLNPYSIRLVTEWPLRSTLDPEIYGPPESAITKELIEKEIGGIMTVEEAIKQKKLFILDYHDLLLPYVEKVRELKGTTLYGSRTLFFSYPSGTLRPLAIELTRPPMDGKPQWKQVFTPSWHSTECWLWRLAKAHVLAHDSGYHQLVSHWLRTHCCTEPYIIATNRQLSAMHPINRLLQPHFRYTMEINALAREALVNAGGIIESTFSPGKYSMELSSVAYDKHWRFDHEALPKDLISR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKPQVHQSHQSLKPLVPLSKPFLRGNFHAFRALQSSSSIKNIPKIRIGISPSVNIKAITTFTQKSTQVKAFVTIKPSVGGLVSGFVDDVKDMFGKSLLLELVSAELDPKTGAEKPTIKGFAHRAGEDKDGHIIYESKFEVPPSFGEVGAILVENEHHKEMYLNDIVLDGPRNGPVNITCGSWVQSKHVNKQKRIFFTNKSYLPSQTPNGLTRLRAEELLNLRGDGQGERKTHDRIYDYDVYNDLGVPDFCSELARPVLGGKEHPYPRRCRTGRPPCETDPASESRTLINYVPRDEAFSEIKQLQFSAKTLYSVLHGLVPSLETAIIDTDLGFPYFTTIDKLFNEGVNVPMPETFKEKALWRTILPRLVKGIEDTGKEVLRFETPETMDRDKFFWFRDEEFGRQTLAGLNPYSIRLVTEWPLRSTLDPEIYGPPESAITKELIEKEIGGIMTVEEAIKQKKLFILDYHDLLLPYVEKVRELKGTTLYGSRTLFFSYPSGTLRPLAIELTRPPMDGKPQWKQVFTPSWHSTECWLWRLAKAHVLAHDSGYHQLVSHWLRTHCCTEPYIIATNRQLSAMHPINRLLQPHFRYTMEINALAREALVNAGGIIESTFSPGKYSMELSSVAYDKHWRFDHEALPKDLISR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoxygenase 2, chloroplastic 13S-lipoxygenase that can use linolenic acid as substrates. Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Required for the wound-induced synthesis of jasmonic acid (JA) in leaves.probableP38418
Lipoxygenase 7, chloroplastic Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. This lipoxygenase introduces molecular oxygen exclusively into the C-13 position of linoleic and linolenic acids.probableP38419

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.11.-With incorporation of two atoms of oxygen.probable
1.13.11.12Transferred entry: 1.13.11.12.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IUK, chain A
Confidence level:very confident
Coverage over the Query: 55-75,86-645
View the alignment between query and template
View the model in PyMOL