Citrus Sinensis ID: 006490

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640---

MPGGSGSSSRTGVRVVVVGDRGTGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKRADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS

ccccccccccccEEEEEEccccccHHHHHHHHHcccccccccccccccccccccccccCEEEEEEcccccccccHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHccHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHEEEEcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEccccCEEEEEEEEcccccHHHHccccccccccCEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHHccccccCEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

*************RVVVVGDRGTGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKRADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALR***************RNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARR****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial Rho GTPase 2	Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.	probable	Q5ZM83
Mitochondrial Rho GTPase 1	Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.	probable	P39722
Mitochondrial Rho GTPase	Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.	probable	Q94263

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0V, chain A
Confidence level:very confident
Coverage over the Query: 9-178
View the alignment between query and template
View the model in PyMOL

Template: 2FV8, chain A
Confidence level:very confident
Coverage over the Query: 422-592
View the alignment between query and template
View the model in PyMOL

Template: 3GEE, chain A
Confidence level:confident
Coverage over the Query: 10-33,51-65,78-222
View the alignment between query and template
View the model in PyMOL

Template: 3GEE, chain A
Confidence level:confident
Coverage over the Query: 420-444,462-478,493-620
View the alignment between query and template
View the model in PyMOL

Template: 2RDO, chain 7
Confidence level:confident
Coverage over the Query: 9-252
View the alignment between query and template
View the model in PyMOL

Template: 1NYA, chain A
Confidence level:confident
Coverage over the Query: 193-274,309-376
View the alignment between query and template
View the model in PyMOL