Citrus Sinensis ID: 006550

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-

MAEGFEPYHVPQQSRRDKLRIVAQNHPSVVCVESSSSAPAPAAGLLPLYDASSLLSSSDLLTAHEFQHQQQQDNKATNPVCVVKEEGVNLMGFVGGASTSSHHNHHPYLDPHSTLHNLNPSSILDINNNNNPFLFTAPHNLQNQLRDFDQSYNGGEGSSEVVLFKPEPLALSLSSHHTTQNNSLPLELNLQRYGSAIYGDHRVTSTGYVVPSSSTVAAGASGSTSNEVSRSTSSLPFGPFTGYASILKGSRFLKPAQQLLEEFCDVGQGVFAEKNYTVDSSLMDPPLVNLNASGIVVDDGDGSDNRRKKSRLISMLDEVYRRYKQYYQQMQAAVASFEYVAGLGNAAPFANLALKAMSKHFRSLKNAITDQLQFTNKAQIQANRGKDEASTFGSTDRGPYGHRPVLNSGFIERQSQPVWRPQRGLPERAVTVLRAWLFEHFLHPYPTDTEKLMLAKQTGLSRSQVSNWFINARVRLWKPMVEEIHMLETRQGQKATQREEQSANRSSDHLPSSNSLPSENPSTSTQRVQETPSKRSRDEFPDIPVGNEEPPNLSYNSLSNHPHVGVGVSMAGGNSGVSLTLGLYQNNGIGLSEPYPISAAQRFGLVHETSSEGFVLSGYEAQSRIFGRDVIGGQLLHDFVG

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccc

*****EP*HVPQQSRRD*************************************************************PVCVVKEEGVNLMGFVG*****************************************************************************************PLELNLQRYGSAIYG*************************************FGPFTGYASILKGSRFLKPAQQLLEEFCDVG******************************************SRLISMLDEVYRRYKQYYQQMQAAVASFEYVAGLGNAAPFANLALKAMSKHFRSLKNAITDQLQF**********************************GFI******VWRPQRGLPERAVTVLRAWLFEHFLHPYPTDTEKLMLAKQTGLSRSQVSNWFINARVRLWKPMVEEIHML****************************************************************************VGVGVSMAGGNSGVSLTLGLYQNNGIGLSEPYPISAAQRFGL********FVLSG*****RIFGRDVIGGQLLHDFVG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BEL1-like homeodomain protein 9	Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate.	probable	Q9LZM8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B72, chain B
Confidence level:confident
Coverage over the Query: 420-492
View the alignment between query and template
View the model in PyMOL