Citrus Sinensis ID: 006565

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640

MEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAAAREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLAEKEEEMKEKATKIEHAEQCLTTLRLELKAAESKMRSYEVEISSQKLETKELSEKLEAVNAKAQSFEREARIMEQDKVYLEQKYKSEFERFEEVQERCKVAEKEAKKATELADRERAEAAAARKGKSEFENLAMERMAVIERVQRQIESLERQKTDLTNEVNRIRESELEALSKVALLEARVEEREKEIESLLESNNEQRASTVKKLEDLLESERRSRAAANAMAERLSLEVQSAQAKLDEMQQELTKARLNETALGSKLRAVSHGKRARADDYEAGVGSVQEMDTNDKVLRANKRSRSTTSPLKYTQPEDGGSVFRGDDDNLSQQSNQEDYTKFTVQKLKQELTKHNFGAELLQLRNPNKKEILALYEKCILQKS

ccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHccc

**************************ASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSE**SLMLKYR*********************************************************************************************************************************KRKYGVAVRE*****************************************************CLTTL**********************************************************************************************************************************************************************************************************************************************************************************************************************FTVQKLKQELTKHNFGAELLQLRNPNKKEILALYEKCIL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSExxxxxxxxxxxxxxxxxxxxxxxxxxxxKSEYLKRYDDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQKAMEDQVCSExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYGVAVREAKAALEKAAIVQERTSKEMQQREDVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAAARKGKSEFENLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALSKxxxxxxxxxxxxxxxxxxxxxxxxxxxxTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxETALGSKLRAVSHGKRARADDYEAGVGSVQEMDTNDKVLRANKRSRSTTSPLKYTQPEDGGSVFRGDDDNLSQQSNQEDYTKFTVQKLKQELTKHNFGAELLQLRNPNKKEILALYEKCILQKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 195-267
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 471-504
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 413-437
View the alignment between query and template
View the model in PyMOL

Template: 1C1G, chain A
Confidence level:confident
Coverage over the Query: 220-512
View the alignment between query and template
View the model in PyMOL

Template: 2V66, chain B
Confidence level:probable
Coverage over the Query: 147-188,203-268
View the alignment between query and template
View the model in PyMOL

Template: 1F5N, chain A
Confidence level:probable
Coverage over the Query: 4-62
View the alignment between query and template
View the model in PyMOL

Template: 1ZRJ, chain A
Confidence level:probable
Coverage over the Query: 590-636
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3ol1, chain A		probable	Alignment \| Template Structure