Citrus Sinensis ID: 006567


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640
MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPPESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAYMLDSASLPSETLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSVWLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLTGPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHLHSVIWPGETLSKPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQFVAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRKLNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLSTLFFAHSK
ccEEEEHHHHHHHHHHHHccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccccEEEEccccccccccccccEEEcccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEEccHHHHHcccccccccccccEEEEEEECccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccEEECcccccccccccccccccccccccHHHHHHHHHHccEECccccEEEcccccccccEEEEEEcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccEEEEcccccccccccEECcccccEEEEHHHHHHHHHHHccccCEEEEEEcccccccccHHHHHHHHHcccccEEEccEEEEcccccccccccccccccEEEEEECccccccccEECccccHHHHHHHHHHHHHHHHHEEEEEccccccccccccccEEEHHHHHHHHccccccc
*KTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPPESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAYMLDSASLPSETLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSVWLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLTGPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHLHSVIWPGETLSKPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQFVAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRKLNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLSTLFFAH**
xxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPPESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAYMLDSASLPSETLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSVWLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLTGPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHLHSVIWPGETLSKPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQFVAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRKLNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLSTLFFAHSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate receptor 3.3 Glutamate-gated receptor that probably acts as non-selective cation channel, at least in roots and hypocotyls. Can be triggered by Ala, Asn, Cys, Glu, Gly, Ser and glutathione (a tripeptide consisting of Glu-Gly-Cys). May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.probableQ9C8E7
Glutamate receptor 3.1 Glutamate-gated receptor that probably acts as non-selective cation channel. Involved in root development. May regulate cell proliferation and cell death in the root apex.probableQ7XP59

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E4U, chain A
Confidence level:very confident
Coverage over the Query: 27-338,352-422,441-460
View the alignment between query and template
View the model in PyMOL
Template: 1YAE, chain A
Confidence level:very confident
Coverage over the Query: 463-571
View the alignment between query and template
View the model in PyMOL
Template: 3QEL, chain A
Confidence level:probable
Coverage over the Query: 29-190,203-266,280-285,298-306,317-413,433-449
View the alignment between query and template
View the model in PyMOL
Template: 3T9X, chain B
Confidence level:probable
Coverage over the Query: 484-605
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3kg2, chain A very confident Alignment | Template Structure