Citrus Sinensis ID: 006623

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------64
MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFPVA
cccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccEEEHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHcccccccEEEccHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHcccccccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEEccccccEEEEEEcccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHccccHHHHccEEEEEcccccccEEEEcccccHHHHHccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccc
cccccccccccccccccccEEEEHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccHccccccccHHHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHcccccHEEEEcccHccHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHccccHHcccccccccEEEEEEcccHHHHHHHHHHHHHHcccccccccccccHHHHcHHHHHHHHHHHHHHHHcccEEEEHHHHccccEEEEEEcccccEccccHHHHHHHHHHHHHHHHHHHcccEEEEEHHHccHHHHccccEEEEEEcccccEEEEEcccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHccHHHHHHEEEEccccccccEEEEEccccHHHHHccccccEEEEcccccHHHHHcHcccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccc
maskpgiltewpwkplgsykhvvlapwamhsiycfigsrkserdyaYFLIFPFLLLRMLHDQIWISLSRYRTAKrnnrivdkaiefdqvdrernwddqiVFNGLIFYIVRMlippsysnlrfwrsdGVILTILVHMGPVEFLYYWFHRALHHHYLysryhshhhssvvtepitsviHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFmnnmghcnfefipmwlftvfpplkflmytpsyhslhhtqfrtnyslfmpiydyiygtidrssdsVYEKSLkrsgeeeeesaddvdvvhlthlttpesiYHLRIGFaslaskphrytYTLSQWYLQLLWPFTASCSVLVSWIYGrtfvsesntldklklqtwVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLlnqgeelnrngeiylerqpnklkikvVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLvgddltgkeqarapkgtifipytqipprklrkdcfyhstpamiippslsnmhsceNWLGRRVMSAWRIAGIIHALegwdlnecgqtmcDIHQVWHAslrhgfrplfpva
maskpgiltewpwkplGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSryrtakrnnrivdkaiefdqvdrernwdDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRsgeeeeesaddvdvVHLTHLttpesiyhLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVsesntldklklqtwvVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEqarapkgtifipytqipprkLRKDCFYHStpamiippslsNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFPVA
MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFhralhhhylysryhshhhssVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGeeeeeSADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGtvtankvanavaSSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFPVA
******ILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTID************************VDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLF***
***KPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDS***************SADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATI***************AQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLF***
MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSS*********************VDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFPVA
*****GILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFP**
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPLFPVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query638 2.2.26 [Sep-21-2011]
F4HVY0625 Protein ECERIFERUM 1 OS=A yes no 0.968 0.988 0.628 0.0
F4HVX7627 Protein CER1-like 1 OS=Ar no no 0.968 0.985 0.576 0.0
F4IR05613 Protein CER1-like 2 OS=Ar no no 0.946 0.985 0.570 0.0
Q8H1Z0632 Protein ECERIFERUM 3 OS=A no no 0.960 0.969 0.348 1e-105
Q8J207356 C-5 sterol desaturase OS= N/A no 0.221 0.396 0.266 7e-08
Q6ZNB7445 Alkylglycerol monooxygena yes no 0.194 0.278 0.300 4e-06
Q7SBB6344 Probable C-5 sterol desat N/A no 0.221 0.409 0.24 4e-05
Q8BS35447 Alkylglycerol monooxygena yes no 0.194 0.277 0.274 0.0001
Q96IV6333 Uncharacterized protein C no no 0.291 0.558 0.213 0.0001
Q5M8F9446 Alkylglycerol monooxygena yes no 0.195 0.280 0.263 0.0001
>sp|F4HVY0|CER1_ARATH Protein ECERIFERUM 1 OS=Arabidopsis thaliana GN=CER1 PE=1 SV=1 Back     alignment and function desciption
 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/638 (62%), Positives = 512/638 (80%), Gaps = 20/638 (3%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MA+KPG+LT+WPW PLGS+K++V+APWA+HS Y F+     +RD  YFL+FPFLL R+LH
Sbjct: 1   MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSRY T+    RIVDK I+F+QVDRE NWDDQI+FNG++FYI   L+P +   L
Sbjct: 61  NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEA-KQL 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
            +WR+DGV++  L+H GPVEFLYYW H+ALHHH+LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PWWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YF+LFAIPL+TT++ K ASI SF GYIIY+DFMNNMGHCNFE IP  LF +FPPLK
Sbjct: 180 EHIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           FL YTPSYHSLHHTQFRTNYSLFMP+YDYIYGT+D S+D++YEK+L+R         D V
Sbjct: 240 FLCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGD-------DIV 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTPESIYHLRIG AS AS P  Y     +W+++LLWPFT S S++ +  Y R
Sbjct: 293 DVVHLTHLTTPESIYHLRIGLASFASYPFAY-----RWFMRLLWPFT-SLSMIFTLFYAR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
            FV+E N+ +KL LQ+WV+PRY +QY L WR+EAIN++IE+AILEAD KGVKV+SLGL+N
Sbjct: 347 LFVAERNSFNKLNLQSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELNRNGE+Y+   P+ +K+++VDGS LAAAVV+NS+PK T  V++ G +T  KVA  
Sbjct: 407 QGEELNRNGEVYIHNHPD-MKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLT--KVAYT 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYA-AHKTIWLVGDDLTGKEQ 539
           +AS+LCQ G++V+T+  D+YEK++  +P E + +LV  TS A +   +WLVG+  T +EQ
Sbjct: 464 IASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVYLTSEALSSNKVWLVGEGTTREEQ 523

Query: 540 ARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAG 599
            +A KGT+FIP++Q P ++LR+DC YH+TPA+I+P SL N+HSCENWL R+ MSA R+AG
Sbjct: 524 EKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAG 583

Query: 600 IIHALEGWDLNECGQT--MCDIHQVWHASLRHGFRPLF 635
           I+HALEGW+++ECG +  + D+ QVW A L HGF+PL 
Sbjct: 584 ILHALEGWEMHECGTSLLLSDLDQVWEACLSHGFQPLL 621
Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. Core component of a very-long-chain alkane synthesis complex. Involved in epicuticular wax biosynthesis and pollen fertility.
Arabidopsis thaliana (taxid: 3702)
>sp|F4HVX7|CERL1_ARATH Protein CER1-like 1 OS=Arabidopsis thaliana GN=At1g02190 PE=2 SV=1 Back     alignment and function description
>sp|F4IR05|CERL2_ARATH Protein CER1-like 2 OS=Arabidopsis thaliana GN=At2g37700 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1Z0|CER3_ARATH Protein ECERIFERUM 3 OS=Arabidopsis thaliana GN=CER3 PE=1 SV=1 Back     alignment and function description
>sp|Q8J207|ERG3_LEPMC C-5 sterol desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 Back     alignment and function description
>sp|Q6ZNB7|ALKMO_HUMAN Alkylglycerol monooxygenase OS=Homo sapiens GN=AGMO PE=1 SV=1 Back     alignment and function description
>sp|Q7SBB6|ERG3_NEUCR Probable C-5 sterol desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 Back     alignment and function description
>sp|Q8BS35|ALKMO_MOUSE Alkylglycerol monooxygenase OS=Mus musculus GN=Agmo PE=2 SV=1 Back     alignment and function description
>sp|Q96IV6|CE004_HUMAN Uncharacterized protein C5orf4 OS=Homo sapiens GN=C5orf4 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8F9|ALKMO_XENTR Alkylglycerol monooxygenase OS=Xenopus tropicalis GN=agmo PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
359489252619 PREDICTED: protein WAX2-like [Vitis vini 0.963 0.993 0.668 0.0
359489254619 PREDICTED: protein WAX2-like [Vitis vini 0.963 0.993 0.670 0.0
297734710631 unnamed protein product [Vitis vinifera] 0.960 0.971 0.666 0.0
359489250619 PREDICTED: protein WAX2-like [Vitis vini 0.963 0.993 0.660 0.0
356520717624 PREDICTED: protein WAX2-like [Glycine ma 0.963 0.985 0.659 0.0
359489248619 PREDICTED: protein WAX2-like [Vitis vini 0.963 0.993 0.660 0.0
356504497627 PREDICTED: protein WAX2-like [Glycine ma 0.963 0.980 0.659 0.0
297734709 2763 unnamed protein product [Vitis vinifera] 0.949 0.219 0.660 0.0
225454042620 PREDICTED: protein WAX2 [Vitis vinifera] 0.963 0.991 0.644 0.0
225454040620 PREDICTED: protein WAX2 [Vitis vinifera] 0.963 0.991 0.645 0.0
>gi|359489252|ref|XP_002263787.2| PREDICTED: protein WAX2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/634 (66%), Positives = 520/634 (82%), Gaps = 19/634 (2%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MASKPGILT+WPW PLG++K+VVLAPWA+H++Y F+   + ERD A+FLIFPFLL RMLH
Sbjct: 1   MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSR+RTAK NNRIVDK IEF+QVDRERNWDDQI+FNG+IFY+    +P + S++
Sbjct: 61  NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGA-SHM 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
             WR+DGV++TIL+H GPVEFLYYW HRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PLWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YFLLF+IPL+T +     SI SFVGYI Y+DFMNNMGHCNFE +P WLF++FP LK
Sbjct: 180 EHIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           +LMYTPS+HSLHHTQFRTNYSLFMP YDY+YGT+D+SSD +YEKSL R     EES    
Sbjct: 240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYMYGTMDKSSDVLYEKSLTRP----EESP--- 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTP+SIYH+R+GFAS+ASKP+     +S+WYL+L+WP T+S  +L+ WI  R
Sbjct: 293 DVVHLTHLTTPDSIYHIRLGFASVASKPY-----ISKWYLRLMWPLTSSYMMLI-WICSR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
           TFV E N  +KLKLQTWV+P+Y +QY L W+ E INSLIEEAIL+A+ +GV V+SLGLLN
Sbjct: 347 TFVLERNHFNKLKLQTWVIPKYRIQYFLKWQNEPINSLIEEAILDAEQRGVNVLSLGLLN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELN  GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T  VL RG ++  KVA  
Sbjct: 407 QGEELNIYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLS--KVAYF 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQA 540
            A +LCQ GI+VAT  +++Y K+ +++  +    L LS +Y AHK IWLVGD LT +EQ 
Sbjct: 464 TALALCQKGIQVATFHEEEYAKINMKLNTKLGGKLALSKNY-AHK-IWLVGDGLTKEEQL 521

Query: 541 RAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGI 600
           +APKGT+FIP++Q PP+++RKDCFYH+TPAM+ P S  NM SCENWL RR MSAWR+AGI
Sbjct: 522 KAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGI 581

Query: 601 IHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 634
           +HALEGW+++ECG  + DI ++W ASL+HGFRPL
Sbjct: 582 LHALEGWNVHECGHAIFDIEKIWEASLQHGFRPL 615

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359489254|ref|XP_002265189.2| PREDICTED: protein WAX2-like [Vitis vinifera] gi|297734711|emb|CBI16762.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734710|emb|CBI16761.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489250|ref|XP_003633900.1| PREDICTED: protein WAX2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520717|ref|XP_003529007.1| PREDICTED: protein WAX2-like [Glycine max] Back     alignment and taxonomy information
>gi|359489248|ref|XP_002265685.2| PREDICTED: protein WAX2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504497|ref|XP_003521032.1| PREDICTED: protein WAX2-like [Glycine max] Back     alignment and taxonomy information
>gi|297734709|emb|CBI16760.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454042|ref|XP_002262785.1| PREDICTED: protein WAX2 [Vitis vinifera] gi|297744850|emb|CBI38118.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454040|ref|XP_002262647.1| PREDICTED: protein WAX2 [Vitis vinifera] gi|297744851|emb|CBI38119.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
UNIPROTKB|Q7XDI3621 Os10g0471100 "CER1 protein, pu 0.967 0.993 0.535 3.1e-186
TAIR|locus:2204813627 AT1G02190 "AT1G02190" [Arabido 0.968 0.985 0.529 6.8e-182
UNIPROTKB|Q109K1595 LOC_Os10g33250 "CER1 protein, 0.695 0.746 0.553 1.4e-181
TAIR|locus:2040666613 AT2G37700 "AT2G37700" [Arabido 0.777 0.809 0.513 1.2e-134
TAIR|locus:2174368632 CER3 "ECERIFERUM 3" [Arabidops 0.956 0.965 0.329 4.6e-89
UNIPROTKB|Q6ETL8628 P0544B02.10 "Os02g0178800 prot 0.959 0.974 0.311 3.1e-76
UNIPROTKB|Q7XDI3 Os10g0471100 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1806 (640.8 bits), Expect = 3.1e-186, P = 3.1e-186
 Identities = 340/635 (53%), Positives = 435/635 (68%)

Query:     1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
             MA+ PG+ TEWPWK LGS+K+V+LAPW  H  Y        E D  Y  I P LLLRMLH
Sbjct:     1 MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH 60

Query:    61 DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
             +Q WI++SR + A+   +IV + IEFDQVDRERNWDDQI+ +G++ Y+  + +P    +L
Sbjct:    61 NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGG-QHL 119

Query:   121 RFWRSDGVILTILVHMGPVEFLYYWFXXXXXXXXXXXXXXXXXXXXVVTEPITSVIHPFA 180
               WR+DG  L  L+H GPVEFLYYWF                    +VTEPITSVIHPFA
Sbjct:   120 PLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFA 179

Query:   181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
             E + Y LLF+IPL+   +   ASI +F  Y+IY+DFMNNMGHCNFE +P WLFT FPPLK
Sbjct:   180 ELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLK 239

Query:   241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGXXXXXSADDV 300
             +LMYTPS+HSLHHTQFRTNYSLFMP YDYIY T+D+SSD++YE SLK +        + V
Sbjct:   240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNN-----EEEEAV 294

Query:   301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
             DVVHLTHLTT  SIYH+R GFA  AS+P+     +S+WY++++WP +   S++++W YG 
Sbjct:   295 DVVHLTHLTTLHSIYHMRPGFAEFASRPY-----VSRWYMRMMWPLSW-LSMVLTWTYGS 348

Query:   361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
             +F  E N + K+++Q+W +PRY   Y L W +EAIN LIE+A+ EAD  G KV+SLGLLN
Sbjct:   349 SFTVERNVMKKIRMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLN 408

Query:   421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGXXXXXXXXXX 480
             Q   LN++GE YL + P KL  ++VDG+SLAAAVVVNS+P+ T  V+L G          
Sbjct:   409 QAHTLNKSGEQYLLKYP-KLGARIVDGTSLAAAVVVNSIPQGTDQVILAGNVSKVARAVA 467

Query:   481 XXSSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQA 540
                +LC+  IKV    K DY  LK  IP     NL  S +  A   +WL+GD L   EQ 
Sbjct:   468 --QALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSFSKTGTAK--VWLIGDGLDSAEQF 523

Query:   541 RAPKGTIFIPYTQIPPRKLRKD-CFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAG 599
             RA KGT+FIPY+Q PP+ +RKD C Y +TPAM +P +L N+HSCENWL RRVMSAWRIAG
Sbjct:   524 RAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAG 583

Query:   600 IIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 634
             I+HALEGW+ +ECG  + D+ +VW A++ HGF P+
Sbjct:   584 ILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCPV 618
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0010025 "wax biosynthetic process" evidence=IDA
GO:0010143 "cutin biosynthetic process" evidence=IDA
GO:0043668 "exine" evidence=IMP
GO:0048653 "anther development" evidence=IMP
TAIR|locus:2204813 AT1G02190 "AT1G02190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q109K1 LOC_Os10g33250 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2040666 AT2G37700 "AT2G37700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174368 CER3 "ECERIFERUM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ETL8 P0544B02.10 "Os02g0178800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4HVY0CER1_ARATHNo assigned EC number0.62850.96860.9888yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010554001
SubName- Full=Chromosome undetermined scaffold_268, whole genome shotgun sequence; (618 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
PLN02869620 PLN02869, PLN02869, fatty aldehyde decarbonylase 0.0
pfam12076164 pfam12076, Wax2_C, WAX2 C-terminal domain 3e-83
pfam04116114 pfam04116, FA_hydroxylase, Fatty acid hydroxylase 1e-17
COG3000271 COG3000, ERG3, Sterol desaturase [Lipid metabolism 2e-16
>gnl|CDD|166510 PLN02869, PLN02869, fatty aldehyde decarbonylase Back     alignment and domain information 
 Score = 1039 bits (2687), Expect = 0.0
 Identities = 446/635 (70%), Positives = 533/635 (83%), Gaps = 20/635 (3%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MASKPGILT+WPWKPLGS+K+VVLAPW +HSIY F+   + ERD +YFLIFPFLL RMLH
Sbjct: 1   MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSRYRTAK NNRIVDK IEF+QVDRERNWDDQI+FNG++FY+  M++P + S++
Sbjct: 61  NQLWISLSRYRTAKGNNRIVDKGIEFEQVDRERNWDDQILFNGILFYVGYMILPGA-SHM 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
             WR+DGV++TIL+HMGPVEFLYYW HRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YFLLFAIPL+TT+    ASIA+F GYI Y+DFMNNMGHCNFE IP WLF++FPPLK
Sbjct: 180 EHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           +LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGT+D+SSD++YEKSLKR     EE     
Sbjct: 240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKR----PEEI---P 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTP+SIYHLR+GFASLASKP+       +WYL+L+WP T S S++++WIYGR
Sbjct: 293 DVVHLTHLTTPDSIYHLRLGFASLASKPYIS-----KWYLRLMWPVT-SWSMMLTWIYGR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
           TFV E N  +KL LQTWV+P+Y +QY L W+ E+INSLIEEAILEAD +GVKV+SLGLLN
Sbjct: 347 TFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIEEAILEADKRGVKVLSLGLLN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELNR GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T  VL RG ++  KVA  
Sbjct: 407 QGEELNRYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLS--KVAYF 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIP-VEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQ 539
           +AS+LCQ GI+VAT  +D+YEKL  ++P  E    L+LS +Y+    IWLVGD LT +EQ
Sbjct: 464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNYSE--KIWLVGDGLTEEEQ 521

Query: 540 ARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAG 599
            +A KGT+FIP++Q PP++LRKDCFYH+TPAM+ P S  N+ SCENWL RR MSAWR+AG
Sbjct: 522 KKASKGTLFIPFSQFPPKRLRKDCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAG 581

Query: 600 IIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 634
           I+HALEGW+++ECG TM DI ++W ASL+HGFRPL
Sbjct: 582 ILHALEGWNVHECGYTMFDIEKIWEASLQHGFRPL 616

Length = 620
>gnl|CDD|192933 pfam12076, Wax2_C, WAX2 C-terminal domain Back     alignment and domain information
>gnl|CDD|217907 pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily Back     alignment and domain information
>gnl|CDD|225546 COG3000, ERG3, Sterol desaturase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 638
PLN02869620 fatty aldehyde decarbonylase 100.0
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 100.0
PRK14982340 acyl-ACP reductase; Provisional 100.0
COG5322351 Predicted dehydrogenase [General function predicti 100.0
KOG0873283 consensus C-4 sterol methyl oxidase [Lipid transpo 100.0
COG3000271 ERG3 Sterol desaturase [Lipid metabolism] 99.94
KOG0872312 consensus Sterol C5 desaturase [Lipid transport an 99.91
KOG0874287 consensus Sphingolipid hydroxylase [Lipid transpor 99.83
PF04116114 FA_hydroxylase: Fatty acid hydroxylase superfamily 99.69
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 99.22
PLN02434237 fatty acid hydroxylase 99.07
KOG0539240 consensus Sphingolipid fatty acid hydroxylase [Lip 97.93
PLN02601303 beta-carotene hydroxylase 97.42
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.02
COG0300265 DltE Short-chain dehydrogenases of various substra 97.02
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.97
PRK07424406 bifunctional sterol desaturase/short chain dehydro 96.9
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 96.72
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.7
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.5
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.5
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.35
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.32
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.17
CHL00194 317 ycf39 Ycf39; Provisional 96.12
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.11
PRK13940414 glutamyl-tRNA reductase; Provisional 96.07
PRK09186256 flagellin modification protein A; Provisional 95.94
PLN00203519 glutamyl-tRNA reductase 95.93
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.87
PLN03209 576 translocon at the inner envelope of chloroplast su 95.84
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.68
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.63
PRK06196 315 oxidoreductase; Provisional 95.44
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 95.33
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.28
PRK08618325 ornithine cyclodeaminase; Validated 95.21
PRK06949258 short chain dehydrogenase; Provisional 95.15
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.14
PLN02780320 ketoreductase/ oxidoreductase 95.11
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.05
PRK08339263 short chain dehydrogenase; Provisional 94.98
PRK06482276 short chain dehydrogenase; Provisional 94.93
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 94.92
PRK07326237 short chain dehydrogenase; Provisional 94.92
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 94.86
PRK06101240 short chain dehydrogenase; Provisional 94.86
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 94.84
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.83
PRK08265261 short chain dehydrogenase; Provisional 94.8
PRK05867253 short chain dehydrogenase; Provisional 94.77
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.77
PF10520178 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme 94.76
PRK08340259 glucose-1-dehydrogenase; Provisional 94.73
PRK07454241 short chain dehydrogenase; Provisional 94.69
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 94.68
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.64
PRK07523255 gluconate 5-dehydrogenase; Provisional 94.6
PRK07825273 short chain dehydrogenase; Provisional 94.51
PRK05854 313 short chain dehydrogenase; Provisional 94.46
PRK07063260 short chain dehydrogenase; Provisional 94.45
PRK07024257 short chain dehydrogenase; Provisional 94.38
PLN02896 353 cinnamyl-alcohol dehydrogenase 94.32
PRK08267260 short chain dehydrogenase; Provisional 94.32
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.29
PRK07109 334 short chain dehydrogenase; Provisional 94.27
PRK06194 287 hypothetical protein; Provisional 94.27
PLN02253280 xanthoxin dehydrogenase 94.27
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.26
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 94.26
PRK05993277 short chain dehydrogenase; Provisional 94.26
PRK07890258 short chain dehydrogenase; Provisional 94.26
KOG1208 314 consensus Dehydrogenases with different specificit 94.24
PRK07067257 sorbitol dehydrogenase; Provisional 94.23
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.22
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.21
PRK06500249 short chain dehydrogenase; Provisional 94.2
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 94.17
PRK05884223 short chain dehydrogenase; Provisional 94.15
PRK07478254 short chain dehydrogenase; Provisional 94.15
PTZ00075476 Adenosylhomocysteinase; Provisional 94.15
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.15
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 94.14
PRK09072263 short chain dehydrogenase; Provisional 94.14
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.14
PRK06407301 ornithine cyclodeaminase; Provisional 94.13
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 94.12
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.12
PRK07831262 short chain dehydrogenase; Provisional 94.1
PRK05872 296 short chain dehydrogenase; Provisional 94.1
PRK08017256 oxidoreductase; Provisional 94.06
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 94.05
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.03
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 94.03
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.01
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 94.0
PRK07062265 short chain dehydrogenase; Provisional 93.97
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 93.96
PRK06924251 short chain dehydrogenase; Provisional 93.95
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 93.94
PRK06180277 short chain dehydrogenase; Provisional 93.9
PRK06139 330 short chain dehydrogenase; Provisional 93.9
PRK06138252 short chain dehydrogenase; Provisional 93.9
PRK07102243 short chain dehydrogenase; Provisional 93.89
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.88
PRK05866293 short chain dehydrogenase; Provisional 93.88
PRK12829264 short chain dehydrogenase; Provisional 93.87
PRK05717255 oxidoreductase; Validated 93.83
TIGR02415254 23BDH acetoin reductases. One member of this famil 93.82
PRK06124256 gluconate 5-dehydrogenase; Provisional 93.8
PRK08643256 acetoin reductase; Validated 93.73
PRK06057255 short chain dehydrogenase; Provisional 93.73
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.73
PRK06182273 short chain dehydrogenase; Validated 93.71
PRK06141314 ornithine cyclodeaminase; Validated 93.69
COG2910211 Putative NADH-flavin reductase [General function p 93.69
PRK05599246 hypothetical protein; Provisional 93.66
PRK08251248 short chain dehydrogenase; Provisional 93.66
PRK08862227 short chain dehydrogenase; Provisional 93.63
PRK09135249 pteridine reductase; Provisional 93.62
PRK10538248 malonic semialdehyde reductase; Provisional 93.62
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.62
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.61
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.59
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.58
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.57
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.55
PRK12742237 oxidoreductase; Provisional 93.55
PRK06046326 alanine dehydrogenase; Validated 93.54
PRK12549284 shikimate 5-dehydrogenase; Reviewed 93.51
PRK05876275 short chain dehydrogenase; Provisional 93.48
PRK08213259 gluconate 5-dehydrogenase; Provisional 93.47
PRK08703239 short chain dehydrogenase; Provisional 93.46
PRK06197 306 short chain dehydrogenase; Provisional 93.46
PRK09291257 short chain dehydrogenase; Provisional 93.45
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.42
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.4
PRK12828239 short chain dehydrogenase; Provisional 93.39
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.37
PRK05875276 short chain dehydrogenase; Provisional 93.35
PRK07453 322 protochlorophyllide oxidoreductase; Validated 93.31
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.31
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 93.31
PRK07074257 short chain dehydrogenase; Provisional 93.31
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.3
PRK08177225 short chain dehydrogenase; Provisional 93.29
PRK08263275 short chain dehydrogenase; Provisional 93.24
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.22
PRK12548289 shikimate 5-dehydrogenase; Provisional 93.2
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.17
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.16
PRK07340304 ornithine cyclodeaminase; Validated 93.16
PRK12939250 short chain dehydrogenase; Provisional 93.14
PRK06172253 short chain dehydrogenase; Provisional 93.13
PRK07097265 gluconate 5-dehydrogenase; Provisional 93.12
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 93.11
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.09
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.09
PRK07035252 short chain dehydrogenase; Provisional 93.05
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.05
PRK07774250 short chain dehydrogenase; Provisional 93.04
PRK07832272 short chain dehydrogenase; Provisional 93.03
PRK07677252 short chain dehydrogenase; Provisional 93.02
PRK05693274 short chain dehydrogenase; Provisional 93.01
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 93.01
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.98
PRK06914 280 short chain dehydrogenase; Provisional 92.97
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.96
PRK06953222 short chain dehydrogenase; Provisional 92.95
PRK06823315 ornithine cyclodeaminase; Validated 92.94
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.94
PRK08589272 short chain dehydrogenase; Validated 92.93
PRK06947248 glucose-1-dehydrogenase; Provisional 92.88
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.87
PRK08277278 D-mannonate oxidoreductase; Provisional 92.77
PRK07060245 short chain dehydrogenase; Provisional 92.75
PRK06125259 short chain dehydrogenase; Provisional 92.72
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 92.7
PRK05650270 short chain dehydrogenase; Provisional 92.63
PRK07814263 short chain dehydrogenase; Provisional 92.63
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 92.61
PRK09242257 tropinone reductase; Provisional 92.61
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.58
PLN00198 338 anthocyanidin reductase; Provisional 92.57
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.55
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 92.55
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.5
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.49
PRK07775274 short chain dehydrogenase; Provisional 92.45
PLN02427 386 UDP-apiose/xylose synthase 92.43
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 92.43
PRK12746254 short chain dehydrogenase; Provisional 92.4
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.39
PRK07589346 ornithine cyclodeaminase; Validated 92.38
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.37
PRK07904253 short chain dehydrogenase; Provisional 92.36
PRK08264238 short chain dehydrogenase; Validated 92.35
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 92.33
PRK07041230 short chain dehydrogenase; Provisional 92.29
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.28
PRK07806248 short chain dehydrogenase; Provisional 92.16
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.14
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.11
PRK06181263 short chain dehydrogenase; Provisional 92.1
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.09
PRK06841255 short chain dehydrogenase; Provisional 92.08
PLN02494477 adenosylhomocysteinase 92.04
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 92.02
PRK06484520 short chain dehydrogenase; Validated 92.02
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 92.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 91.94
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 91.92
TIGR01746 367 Thioester-redct thioester reductase domain. It has 91.92
PLN02583 297 cinnamoyl-CoA reductase 91.9
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 91.9
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 91.88
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 91.85
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.83
PRK07576264 short chain dehydrogenase; Provisional 91.75
PRK12743256 oxidoreductase; Provisional 91.72
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 91.69
PRK06179270 short chain dehydrogenase; Provisional 91.65
PRK07069251 short chain dehydrogenase; Validated 91.62
KOG0725270 consensus Reductases with broad range of substrate 91.53
PRK08628258 short chain dehydrogenase; Provisional 91.47
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.46
PRK08219227 short chain dehydrogenase; Provisional 91.45
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 91.33
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 91.32
PRK06199379 ornithine cyclodeaminase; Validated 91.31
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 91.29
PLN02214 342 cinnamoyl-CoA reductase 91.26
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 91.25
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 91.23
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 91.14
PRK12747252 short chain dehydrogenase; Provisional 91.11
PRK12937245 short chain dehydrogenase; Provisional 91.03
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.98
PRK08936261 glucose-1-dehydrogenase; Provisional 90.97
PRK07985294 oxidoreductase; Provisional 90.92
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.9
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.89
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.88
PRK08303 305 short chain dehydrogenase; Provisional 90.84
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 90.8
PRK08278273 short chain dehydrogenase; Provisional 90.77
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.75
PRK06483236 dihydromonapterin reductase; Provisional 90.65
PRK06123248 short chain dehydrogenase; Provisional 90.65
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 90.63
PRK14027283 quinate/shikimate dehydrogenase; Provisional 90.62
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 90.62
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.59
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 90.46
PRK06484 520 short chain dehydrogenase; Validated 90.45
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 90.44
PRK12935247 acetoacetyl-CoA reductase; Provisional 90.41
PRK09134258 short chain dehydrogenase; Provisional 90.4
PRK06720169 hypothetical protein; Provisional 90.39
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.38
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.32
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 90.26
PLN02650 351 dihydroflavonol-4-reductase 90.26
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 90.25
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 90.21
PRK07577234 short chain dehydrogenase; Provisional 90.21
PRK07856252 short chain dehydrogenase; Provisional 90.18
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 90.18
PLN02686 367 cinnamoyl-CoA reductase 90.06
PRK06114254 short chain dehydrogenase; Provisional 90.03
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 89.98
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 89.98
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 89.86
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 89.81
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 89.77
PRK07023243 short chain dehydrogenase; Provisional 89.74
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.73
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 89.67
PRK06198260 short chain dehydrogenase; Provisional 89.65
PRK12827249 short chain dehydrogenase; Provisional 89.65
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 89.6
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 89.42
PRK08226263 short chain dehydrogenase; Provisional 89.42
PRK09496453 trkA potassium transporter peripheral membrane com 89.41
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 89.29
PRK06523260 short chain dehydrogenase; Provisional 89.27
PRK06128300 oxidoreductase; Provisional 89.26
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 89.25
PRK05855582 short chain dehydrogenase; Validated 89.18
PRK00676338 hemA glutamyl-tRNA reductase; Validated 89.05
PLN03139386 formate dehydrogenase; Provisional 89.0
PRK07201 657 short chain dehydrogenase; Provisional 88.97
PRK07424406 bifunctional sterol desaturase/short chain dehydro 88.94
PLN02778 298 3,5-epimerase/4-reductase 88.93
PRK12938246 acetyacetyl-CoA reductase; Provisional 88.91
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 88.79
PRK06398258 aldose dehydrogenase; Validated 88.79
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 88.77
PRK07791286 short chain dehydrogenase; Provisional 88.72
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 88.62
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 88.61
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 88.57
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 88.28
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.04
PRK12744257 short chain dehydrogenase; Provisional 88.01
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 87.71
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 87.68
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 87.35
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 87.28
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 87.25
PRK06701290 short chain dehydrogenase; Provisional 87.22
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 87.19
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 87.17
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 86.98
PLN02695 370 GDP-D-mannose-3',5'-epimerase 86.96
PRK06940275 short chain dehydrogenase; Provisional 86.81
PRK08309177 short chain dehydrogenase; Provisional 86.52
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 86.49
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 86.39
PLN02653 340 GDP-mannose 4,6-dehydratase 86.23
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 86.16
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 86.12
PRK08291330 ectoine utilization protein EutC; Validated 86.05
PRK08655 437 prephenate dehydrogenase; Provisional 85.99
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 85.96
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 85.94
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 85.84
PRK12824245 acetoacetyl-CoA reductase; Provisional 85.63
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 85.6
PLN00015 308 protochlorophyllide reductase 85.52
PRK08324681 short chain dehydrogenase; Validated 85.38
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 85.36
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 85.2
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 85.18
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 85.17
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 85.13
PRK12367245 short chain dehydrogenase; Provisional 85.1
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.02
PLN02240 352 UDP-glucose 4-epimerase 84.93
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.92
COG1028251 FabG Dehydrogenases with different specificities ( 84.89
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 84.85
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.83
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 84.77
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 84.65
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 84.6
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 84.45
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 84.44
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 84.38
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 84.28
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 84.25
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 83.9
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 83.76
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 83.47
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 83.01
KOG0409 327 consensus Predicted dehydrogenase [General functio 82.9
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 82.83
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 82.67
PLN02996 491 fatty acyl-CoA reductase 82.64
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 82.61
PRK09496 453 trkA potassium transporter peripheral membrane com 82.61
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 82.21
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 81.99
PLN00016 378 RNA-binding protein; Provisional 81.72
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 81.01
smart00822180 PKS_KR This enzymatic domain is part of bacterial 80.67
PRK10675 338 UDP-galactose-4-epimerase; Provisional 80.56
PRK10669558 putative cation:proton antiport protein; Provision 80.27
COG0569225 TrkA K+ transport systems, NAD-binding component [ 80.21
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 80.17
COG3268 382 Uncharacterized conserved protein [Function unknow 80.16
>PLN02869 fatty aldehyde decarbonylase Back     alignment and domain information 
Probab=100.00  E-value=3.8e-199  Score=1622.45  Aligned_cols=617  Identities=72%  Similarity=1.276  Sum_probs=592.9

Q ss_pred             CCCCCCCCCCCCCCCCCCccEEeehHHHhhhhhhhhcCccccccccchhHHHHHHHHHHHHhHHHHHhhchhhHhcCcCC
Q 006623            1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIV   80 (638)
Q Consensus         1 ~~~~~~~l~~wpw~~lg~~ky~~~~P~v~~~~~~~~~~~~~~~~~~~~~il~~~~lRyl~~~~wi~~~~~~~~~~k~KIq   80 (638)
                      ||++||+||+|||++||||||++|+|+|++++|++.++++++.|+.|+++++++++|++++|+|++++|++++++|+||+
T Consensus         1 ma~~pg~lt~wpW~~lG~~Ky~~~~p~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~l~~q~W~s~sr~~~~~~~~ri~   80 (620)
T PLN02869          1 MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLHNQLWISLSRYRTAKGNNRIV   80 (620)
T ss_pred             CCCCCcccccCcccccCCeeeeeehHHHHHHHHHHHhcccccccccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhceeee
Confidence            99999999999999999999999999999999999988777767789999999999999999999999999999999999


Q ss_pred             CCCCcccchhhhhcchhhHHHHHHHHHHHHhhcCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHhhHhhhhhhcc
Q 006623           81 DKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYH  160 (638)
Q Consensus        81 ~~~~~~~qvdrE~~~~n~iIl~~li~~~~~~~~P~~~~~lP~W~~~g~i~~lll~~lv~Df~~Yw~HRllH~~~Ly~r~H  160 (638)
                      +++++|+|+|||++||||+|+++++++++++.+| ..+.+|.|++.|++..+++|+++.|++|||+||++|++++||++|
T Consensus        81 ~~~i~f~QvDre~~wDd~iil~~l~~~~~~~~~p-~~~~~P~W~~~g~l~~~Llhv~~~Df~fYW~HRllH~~~LYwr~H  159 (620)
T PLN02869         81 DKGIEFEQVDRERNWDDQILFNGILFYVGYMILP-GASHMPLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYH  159 (620)
T ss_pred             ccCCCceeeccccccchHHHHHHHHHHHHHHhhh-hhhcCcccccchHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHH
Confidence            9999999999999999999999999999999999 799999999999999999999999999999999999999999999


Q ss_pred             ccCccCcCCCchhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHhhccCCceecccccccccCCcc
Q 006623          161 SHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240 (638)
Q Consensus       161 kvHHss~~p~~~ta~~~hplE~ll~~~~f~iPll~~~llg~~s~~~i~~y~i~~~~~~~~~Hsg~e~~P~~~~~~lp~L~  240 (638)
                      ++||++.+|+|+++..+++.|++.+.+++.+|+++..+++..|+.++++|+++.+++++++|||+|++|+++++.+|+++
T Consensus       160 kvHHss~~~~P~Ts~~HP~~E~L~y~ll~~IPLllli~~g~~hi~t~~~yli~~~f~~~~gHSN~El~P~~~~~~~ppLk  239 (620)
T PLN02869        160 SHHHSSIVTEPITSVIHPFAEHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK  239 (620)
T ss_pred             hhccCCCCCCchhhhcCcHHHHHHHHHHHHHHHHHHhhcccchHHHHHHHHHHHHHHhcccccCccccccchhccCCcch
Confidence            99999999999998754445778777778899988777777789999999999999999999999999999988889999


Q ss_pred             cccCCchhhhhhhcCCCCCcCCCchhhhhhcCCCCCCCchHHHHHhhcCCccccccCCCCceeeecccCCccccccccch
Q 006623          241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIG  320 (638)
Q Consensus       241 ~li~tp~~H~lHH~~~~~NYG~~f~~WDrLFGT~~~~~~~~~~~~~~~~~~~~~~~~~~pd~v~l~H~~~~~s~~h~~~~  320 (638)
                      |+++||++|++||+++++|||++|++||++|||+++++|+++|+...  +.++     +||||||||+||++|+||+|||
T Consensus       240 yll~TPsfHdlHHs~fd~NYGlfF~~WDrLFGT~d~~s~~l~e~~~~--~~~~-----~pd~V~l~H~t~~~s~~h~~~~  312 (620)
T PLN02869        240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLK--RPEE-----IPDVVHLTHLTTPDSIYHLRLG  312 (620)
T ss_pred             heecCchHHhHHhccCCcCcccchHHHHhccCCCCCCchhHHHHhhc--Cccc-----CCCEEEEeccCCHHHhhccchH
Confidence            99999999999999999999999999999999999999999999987  4344     9999999999999999999999


Q ss_pred             hhhhccCCccccccCcchhccchhhHHHHHHHHHHHHhcceEEEeecccCcccceeEEeeccCcccccchhhHHHHHHHH
Q 006623          321 FASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIE  400 (638)
Q Consensus       321 ~~~~~s~p~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~w~~pr~~~~y~~~~~~~~in~~I~  400 (638)
                      |||+||+||+     ++||||||||+|+++|+++ |+|||||++|+|+|||+++|||+||||||||++|+++|+||++||
T Consensus       313 ~~s~as~p~~-----~~~~l~~~wp~~~~~m~~~-w~~~~~f~~~~~~~~~~~~~tw~vpr~~~qy~~~~~~~~in~~Ie  386 (620)
T PLN02869        313 FASLASKPYI-----SKWYLRLMWPVTSWSMMLT-WIYGRTFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIE  386 (620)
T ss_pred             HHHhccCCcc-----chhHHHHHHHHHHHHHHHH-HHhCCceEeeeeeccceeeeEEEeccccccccCchhhhhHHHHHH
Confidence            9999999999     9999999999999999999 799999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCcEEEecccccccccccCCceeeecCCCCcceeeecCChhHHHHHHhcCcCCCcEEEEecccCchhhHHH
Q 006623          401 EAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA  480 (638)
Q Consensus       401 ~Ai~~A~k~G~kv~~LG~ln~~e~ln~~g~~~~~k~p~~L~irvv~Gnsltaavv~~~ip~~~~~V~~~Gatg~~kig~a  480 (638)
                      +||++|||+||||+|||+|||+|+|||+|++||+|||+ ||||||||||||||||+|+||++++|||++|||+  |||||
T Consensus       387 ~ail~ad~~Gvkv~sLg~LNk~~~LN~~G~l~v~k~p~-L~vrvv~G~tLtaAvvln~ip~~~~~vfl~G~~s--K~~ra  463 (620)
T PLN02869        387 EAILEADKRGVKVLSLGLLNQGEELNRYGELYIHRNPK-LKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLS--KVAYF  463 (620)
T ss_pred             HHHHHHHhcCCEEEechhcchhhhhcCCceEeeecCCC-cceEEEeCCchHHHHHHHhcCCCCceEEEecCcc--HHHHH
Confidence            99999999999999999999999999999999999999 9999999999999999999999999999999996  99999


Q ss_pred             HHHHHhccCcEEEecchhhHHHHHhhCCc-chhchhhhccccccceEEEeecCcCChhhhhcCCCCceeecccccCCcCC
Q 006623          481 VASSLCQMGIKVATICKDDYEKLKLRIPV-EAQHNLVLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKL  559 (638)
Q Consensus       481 va~~L~~~~~~v~~~~~~~~~~l~~~~~~-~~~~~l~~~~~~~~~~i~w~vg~~~~~~~q~~a~~G~~f~~~~~~~~~~~  559 (638)
                      ||.+||||||||++.++|||++||+|++. +++++|+++|++ ..|+ |+|||+++++||++|||||+||||||+|+++.
T Consensus       464 ia~~lc~r~i~~~t~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~~k~-w~vg~~~~~~eq~~A~~gt~f~~~~~~p~~~~  541 (620)
T PLN02869        464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNY-SEKI-WLVGDGLTEEEQKKASKGTLFIPFSQFPPKRL  541 (620)
T ss_pred             HHHHHHhcCCeEeecCHHHHHHHHHhccchhhhhhEEEeecc-Ccee-EEecCCCCHHHHhhCCCCCeecccccCCchhh
Confidence            99999999999666899999999999988 899999999987 5699 79999999999999999999999999999999


Q ss_pred             CCCceeecCCccccCCCCccccccccccCcchhHHHHHhhhhhhhcCCCCCccchh-hhhHHHHHHHHHhcCCccCCCC
Q 006623          560 RKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT-MCDIHQVWHASLRHGFRPLFPV  637 (638)
Q Consensus       560 R~dc~y~~~~a~~~P~~~~~~~~~e~~~p~~~~~Ac~a~~~v~alEgw~~~e~G~i-v~~i~~i~~aa~kHGF~p~~~~  637 (638)
                      ||||+|+++|||++|+++||++|||||||||+|+||||||||||||||++|||| | |++||++|+||+||||+|+...
T Consensus       542 R~dC~Y~~~pam~~p~~~~~~~sce~~l~r~v~~a~~~~givh~legw~~he~g-~~v~~id~~W~aal~hgf~p~~~~  619 (620)
T PLN02869        542 RKDCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAGILHALEGWNVHECG-YTMFDIEKIWEASLQHGFRPLLIP  619 (620)
T ss_pred             hccccccCCccccCChhhcccchhhccccchhhhHhhhcceeeeecCccccccc-cccccHHHHHHHHHHcCCccCCCC
Confidence            999999999999999999999999999999999999999999999999999999 8 9999999999999999998754

>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG0873 consensus C-4 sterol methyl oxidase [Lipid transport and metabolism] Back     alignment and domain information
>COG3000 ERG3 Sterol desaturase [Lipid metabolism] Back     alignment and domain information
>KOG0872 consensus Sterol C5 desaturase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0874 consensus Sphingolipid hydroxylase [Lipid transport and metabolism] Back     alignment and domain information
>PF04116 FA_hydroxylase: Fatty acid hydroxylase superfamily; InterPro: IPR006694 This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02434 fatty acid hydroxylase Back     alignment and domain information
>KOG0539 consensus Sphingolipid fatty acid hydroxylase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02601 beta-carotene hydroxylase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF10520 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme hybrid localisation domain; InterPro: IPR019547 This entry represents part of the transcript of the fusion of two genes, the UEV1 Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 50.6 bits (120), Expect = 2e-06
 Identities = 79/576 (13%), Positives = 167/576 (28%), Gaps = 170/576 (29%)

Query: 151 HHHYLYSRYHSHHHSSVVTEPI----TSVIHPFAEHIVY-FLLFAIPLVTTMVLKNASIA 205
           HHH        HHH    T         ++  F +  V  F    +  +   +L    I 
Sbjct: 1   HHH--------HHHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEID 52

Query: 206 SFVG---------YI----------IYVDFMNNMGHCNFEFIPMWLFTVF------PPLK 240
             +           +          +   F+  +   N++    +L +        P + 
Sbjct: 53  HIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYK----FLMSPIKTEQRQPSMM 108

Query: 241 FLMYTPSYHSLH----------------HTQFRTN-YSLFMPIYDYIYGTIDRSSDSVYE 283
             MY      L+                + + R     L       I G +  S  +   
Sbjct: 109 TRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG-SGKTWVA 167

Query: 284 KSLKRSGEEEEESADDVDVVHLTHLTTPESI--------YHLRIGFASLASKPHRYTYTL 335
             +  S + + +    +  ++L +  +PE++        Y +   + S +         +
Sbjct: 168 LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRI 227

Query: 336 SQWYLQLLWPFTASCSVLVSWIYGRTF-----VSESNTLDKLKL--QTWVVPRYIVQYNL 388
                +L         +L S  Y         V  +   +   L  +  +  R+      
Sbjct: 228 HSIQAELR-------RLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRF------ 274

Query: 389 PWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEI---YLERQPNKLKIKVV 445
              ++  + L         A     ISL   +     +    +   YL+ +P  L  +V+
Sbjct: 275 ---KQVTDFL--------SAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323

Query: 446 DGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKL 505
             +    +++  S+    A       V  +K+   + SSL  +        +  +++L +
Sbjct: 324 TTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE---PAEYRKMFDRLSV 380

Query: 506 -----RIPVEAQHNLVLSTSYAAHKTIW---------LVGDDLTGKE--QARAPKGTIFI 549
                 IP       +LS        IW         +V + L      + +  + TI I
Sbjct: 381 FPPSAHIPTI-----LLS-------LIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISI 428

Query: 550 PYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDL 609
           P   +   +L+               +   +H       R ++  + I       + +D 
Sbjct: 429 PSIYL---ELKVKL-----------ENEYALH-------RSIVDHYNI------PKTFDS 461

Query: 610 NECGQTMCD----IHQVWH-ASLRHG-----FRPLF 635
           ++      D     H   H  ++ H      FR +F
Sbjct: 462 DDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVF 497

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.61
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.55
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.36
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.24
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.11
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.09
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.01
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.01
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.95
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.9
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.89
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.85
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 95.85
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.83
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 95.82
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.81
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.78
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 95.78
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.76
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.73
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.73
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.72
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 95.72
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.71
3imf_A257 Short chain dehydrogenase; structural genomics, in 95.7
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 95.64
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.62
3rih_A293 Short chain dehydrogenase or reductase; structural 95.61
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.59
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 95.59
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 95.58
1spx_A278 Short-chain reductase family member (5L265); paral 95.56
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.56
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.55
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 95.52
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.52
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.5
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 95.46
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.45
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 95.45
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 95.43
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.42
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 95.42
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.42
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.41
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 95.41
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.4
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.4
4eso_A255 Putative oxidoreductase; NADP, structural genomics 95.39
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.36
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.36
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 95.35
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.33
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.33
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.33
1xkq_A280 Short-chain reductase family member (5D234); parra 95.33
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 95.32
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 95.31
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.31
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.3
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.28
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 95.28
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 95.28
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.26
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 95.25
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 95.24
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.22
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.21
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 95.21
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.17
1nff_A260 Putative oxidoreductase RV2002; directed evolution 95.15
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 95.15
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.14
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.13
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.13
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 95.13
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.12
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.12
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.11
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.1
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 95.1
4f6c_A 427 AUSA reductase domain protein; thioester reductase 95.09
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 95.08
1xhl_A297 Short-chain dehydrogenase/reductase family member 95.06
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.05
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 95.04
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.03
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.03
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.03
3tox_A280 Short chain dehydrogenase; structural genomics, PS 95.02
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.02
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.01
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 94.99
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.98
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.96
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 94.96
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 94.95
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 94.95
4dqx_A277 Probable oxidoreductase protein; structural genomi 94.95
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.94
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 94.94
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.93
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 94.93
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 94.92
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 94.92
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.91
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 94.9
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 94.89
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.87
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 94.86
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 94.86
3tjr_A301 Short chain dehydrogenase; structural genomics, se 94.85
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 94.84
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 94.81
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 94.81
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 94.81
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.8
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.8
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 94.79
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 94.77
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 94.74
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 94.74
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.73
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 94.72
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 94.71
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 94.71
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.7
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 94.69
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 94.69
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 94.69
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 94.68
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 94.68
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 94.67
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 94.65
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.64
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 94.63
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 94.62
1xq1_A266 Putative tropinone reducatse; structural genomics, 94.6
1xq6_A253 Unknown protein; structural genomics, protein stru 94.6
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.59
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.58
3l07_A285 Bifunctional protein fold; structural genomics, ID 94.58
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.55
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 94.54
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 94.54
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 94.53
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 94.52
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 94.52
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.49
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 94.48
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 94.47
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 94.45
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 94.44
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 94.42
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.41
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.4
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 94.39
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.37
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.36
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.36
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.36
3cxt_A291 Dehydrogenase with different specificities; rossma 94.35
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.34
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 94.32
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 94.32
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.3
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 94.26
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.25
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 94.23
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 94.22
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.22
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 94.2
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.19
3edm_A259 Short chain dehydrogenase; structural genomics, ox 94.18
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 94.18
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 94.13
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 94.12
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 94.11
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.11
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 94.11
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 94.09
2rir_A300 Dipicolinate synthase, A chain; structural genomic 94.09
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 94.08
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 94.05
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.03
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 94.02
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 93.96
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 93.93
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 93.93
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 93.91
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.89
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 93.85
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.83
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 93.8
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 93.71
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 93.71
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.69
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 93.69
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 93.67
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 93.67
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 93.67
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 93.64
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 93.63
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 93.63
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 93.59
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 93.57
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.53
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 93.52
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 93.52
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 93.51
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.49
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 93.47
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.45
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 93.44
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 93.42
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.38
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 93.36
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.34
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 93.32
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.31
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 93.29
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 93.29
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 93.28
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 93.21
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 93.17
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 93.13
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 93.09
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.08
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 93.07
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 93.05
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 93.01
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 92.97
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 92.96
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 92.91
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 92.89
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 92.86
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 92.83
3tsc_A277 Putative oxidoreductase; structural genomics, seat 92.82
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 92.8
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 92.77
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 92.76
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 92.73
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 92.5
1id1_A153 Putative potassium channel protein; RCK domain, E. 92.49
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 92.48
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 92.48
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 92.47
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 92.43
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 92.43
3gem_A260 Short chain dehydrogenase; structural genomics, AP 92.42
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 92.41
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.39
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.38
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.36
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.35
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 92.35
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 92.33
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 92.32
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 92.27
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 92.27
3e03_A274 Short chain dehydrogenase; structural genomics, PS 92.26
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 92.21
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.19
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.16
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 92.15
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 92.14
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 92.1
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 92.08
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 92.05
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.02
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 91.92
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 91.92
4f6l_B 508 AUSA reductase domain protein; thioester reductase 91.91
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 91.84
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 91.81
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 91.78
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 91.74
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 91.71
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 91.68
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 91.68
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.68
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 91.67
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 91.63
1ooe_A236 Dihydropteridine reductase; structural genomics, P 91.58
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 91.57
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 91.56
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 91.54
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 91.47
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.45
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 91.3
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 91.15
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 91.15
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 91.13
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 91.08
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 91.02
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 90.81
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 90.78
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 90.77
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 90.75
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 90.74
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 90.72
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 90.57
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 90.54
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 90.52
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.45
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 90.44
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 90.41
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 90.34
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 90.26
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 90.25
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 90.21
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 90.2
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 90.16
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 90.07
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 90.05
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 90.03
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 89.99
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 89.93
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 89.75
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 89.67
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 89.65
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.65
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 89.49
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 89.47
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.37
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 89.37
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 89.34
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 89.31
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 88.66
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 88.58
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 88.5
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 88.45
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 88.44
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 88.34
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 88.32
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 88.22
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.19
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 88.0
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 87.95
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 87.94
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 87.81
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 87.73
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 87.72
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 87.65
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 87.61
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.56
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 87.44
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 87.41
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.39
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 87.36
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 87.34
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 87.34
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 87.34
4g65_A 461 TRK system potassium uptake protein TRKA; structur 87.27
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.27
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 87.19
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 87.11
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.07
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 86.99
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 86.94
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 86.85
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 86.81
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 86.8
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 86.76
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 86.75
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 86.73
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 86.62
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 86.62
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.41
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 86.39
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 86.37
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 86.36
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 86.17
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 86.02
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 86.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 85.98
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 85.97
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 85.85
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 85.8
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 85.48
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 85.41
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 85.41
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 85.37
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 85.33
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 85.27
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 85.17
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 85.15
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 85.04
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 84.92
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 84.92
4ezb_A 317 Uncharacterized conserved protein; structural geno 84.87
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 84.7
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 84.69
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 84.68
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 84.64
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 84.64
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 84.6
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 84.59
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 84.59
4e4y_A244 Short chain dehydrogenase family protein; structur 84.56
3fbg_A346 Putative arginate lyase; structural genomics, unkn 84.37
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 84.17
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 84.05
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 84.04
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 84.01
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 84.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 83.96
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 83.91
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 83.9
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 83.84
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 83.82
4eye_A342 Probable oxidoreductase; structural genomics, niai 83.75
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 83.73
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 83.67
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 83.63
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 83.54
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 83.42
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 83.2
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 83.16
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 83.13
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 83.1
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 83.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 82.9
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 82.86
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 82.76
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 82.58
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 82.58
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 82.49
3gms_A340 Putative NADPH:quinone reductase; structural genom 82.4
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 82.4
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 82.28
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 82.26
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 82.25
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 82.24
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 82.13
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 81.9
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 81.66
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 81.45
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 81.16
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 80.52
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 80.49
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 80.41
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 80.39
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 80.33
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 80.28
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 80.18
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 80.17
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 80.15
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
Probab=96.61  E-value=0.0007  Score=69.66  Aligned_cols=153  Identities=12%  Similarity=0.090  Sum_probs=83.0

Q ss_pred             ecCChhHHHHHHhcCcCCCcEEEEecccCchhhHHHHHHHHhccCc-EEEe--cchhhHHHHHhhCCcchhchhhhcccc
Q 006623          445 VDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGI-KVAT--ICKDDYEKLKLRIPVEAQHNLVLSTSY  521 (638)
Q Consensus       445 v~Gnsltaavv~~~ip~~~~~V~~~Gatg~~kig~ava~~L~~~~~-~v~~--~~~~~~~~l~~~~~~~~~~~l~~~~~~  521 (638)
                      |||-....+.--..+....++|+++|+ |  -+|+++|..|.+.|. +|++  |+.++.+++..++....-.++.+.  .
T Consensus        99 TD~~G~~~~L~~~~~~l~~k~vlvlGa-G--g~g~aia~~L~~~G~~~v~v~~R~~~~a~~la~~~~~~~~~~~~~~--~  173 (277)
T 3don_A           99 TDGIGYVNGLKQIYEGIEDAYILILGA-G--GASKGIANELYKIVRPTLTVANRTMSRFNNWSLNINKINLSHAESH--L  173 (277)
T ss_dssp             CHHHHHHHHHHHHSTTGGGCCEEEECC-S--HHHHHHHHHHHTTCCSCCEEECSCGGGGTTCCSCCEEECHHHHHHT--G
T ss_pred             ChHHHHHHHHHHhCCCcCCCEEEEECC-c--HHHHHHHHHHHHCCCCEEEEEeCCHHHHHHHHHhcccccHhhHHHH--h
Confidence            566555555433334445678999998 5  789999999999998 7888  888887777654332111111111  2


Q ss_pred             ccceEE-EeecCcCChh-----hhhcCCCCceeecccccCCc-----CCC-CCceeecCCccccCCCCccccccccccCc
Q 006623          522 AAHKTI-WLVGDDLTGK-----EQARAPKGTIFIPYTQIPPR-----KLR-KDCFYHSTPAMIIPPSLSNMHSCENWLGR  589 (638)
Q Consensus       522 ~~~~i~-w~vg~~~~~~-----~q~~a~~G~~f~~~~~~~~~-----~~R-~dc~y~~~~a~~~P~~~~~~~~~e~~~p~  589 (638)
                      +.+++| -....+..++     +....++|++++|++-.|..     +.| +-|.+..+..|-+=   |+..++|.|..+
T Consensus       174 ~~aDiVInaTp~Gm~~~~~~~l~~~~l~~~~~V~D~vY~P~~T~ll~~A~~~G~~~~~Gl~MLv~---Qa~~~f~lwtg~  250 (277)
T 3don_A          174 DEFDIIINTTPAGMNGNTDSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVH---QGAESFKIWTNL  250 (277)
T ss_dssp             GGCSEEEECCC-------CCSSCCTTCCSSCEEEESCCSSSSCHHHHHHHHTTCCEECTHHHHHH---HHHHHHHHHHSS
T ss_pred             cCCCEEEECccCCCCCCCcCCCCHHHcCCCCEEEEecCCCCCCHHHHHHHHCcCEEeCCHHHHHH---HHHHHHHHHcCC
Confidence            223343 2222222111     23456889999998844433     222 56777777666542   233344555433


Q ss_pred             chhHHHHHhhhhhhhc
Q 006623          590 RVMSAWRIAGIIHALE  605 (638)
Q Consensus       590 ~~~~Ac~a~~~v~alE  605 (638)
                      +.=...+-+.+..+++
T Consensus       251 ~~~~~~~~~~l~~~~~  266 (277)
T 3don_A          251 EPDIKAMKNIVIQKLK  266 (277)
T ss_dssp             CCCHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHhh
Confidence            3222333344444443
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.49
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.08
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.61
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.59
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.53
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.48
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 96.34
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.31
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.28
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.26
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.24
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.2
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.15
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.14
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.12
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.11
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.1
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.08
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.08
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.05
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.04
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.02
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.02
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.99
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.97
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.94
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 95.93
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 95.92
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.91
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 95.91
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.87
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.85
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 95.83
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 95.82
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.78
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.76
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.72
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.7
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.7
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 95.7
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.59
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.51
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.45
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.37
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.34
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.32
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.17
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 95.13
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.02
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.92
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.87
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 94.79
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 94.76
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.7
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.65
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.41
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.39
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.36
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 94.33
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 94.18
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 94.14
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.07
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.96
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 93.95
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 93.91
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.71
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 93.68
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.48
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.39
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 93.31
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 93.25
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 93.2
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 93.18
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.05
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.01
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 92.99
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.87
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.86
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.75
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.65
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 92.63
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 92.56
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 92.54
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.49
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.18
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.03
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 91.98
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 91.75
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.65
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.53
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 91.2
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 91.16
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 90.91
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 90.71
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.52
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 90.44
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 90.34
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 90.09
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 90.02
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 89.98
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.78
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.6
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.55
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 89.2
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.1
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 88.71
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 88.68
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 88.59
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.56
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 88.53
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.47
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.74
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.72
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 87.65
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 87.62
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 87.56
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 87.49
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 87.48
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.2
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.03
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.0
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 86.8
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 86.64
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 86.26
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 86.02
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 85.08
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 85.0
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.72
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 84.43
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 84.41
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.38
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 84.35
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 84.3
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 84.2
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.98
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.96
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 83.93
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.6
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.54
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 82.67
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 80.5
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 80.29
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamyl tRNA-reductase middle domain
species: Archaeon Methanopyrus kandleri [TaxId: 2320]

Probab=97.49  E-value=7.6e-05  Score=68.39  Aligned_cols=91  Identities=16%  Similarity=0.143  Sum_probs=64.3

Q ss_pred             CCcEEEEecccCchhhHHHHHHHHhccCc-EEEe--cchhhHHHHHhhCCcchhchhhhccc-c-ccceEEEeecC---c
Q 006623          462 TTAHVLLRGTVTANKVANAVASSLCQMGI-KVAT--ICKDDYEKLKLRIPVEAQHNLVLSTS-Y-AAHKTIWLVGD---D  533 (638)
Q Consensus       462 ~~~~V~~~Gatg~~kig~ava~~L~~~~~-~v~~--~~~~~~~~l~~~~~~~~~~~l~~~~~-~-~~~~i~w~vg~---~  533 (638)
                      ..++|+++|+ |  .+|+.+|+.|..+|. ++++  |+.++-++|.++.+.... .+.+..+ . +++.|+...+.   .
T Consensus        23 ~~~~ilviGa-G--~~g~~v~~~L~~~g~~~i~v~nRt~~ka~~l~~~~~~~~~-~~~~~~~~l~~~Divi~atss~~~i   98 (159)
T d1gpja2          23 HDKTVLVVGA-G--EMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGEAV-RFDELVDHLARSDVVVSATAAPHPV   98 (159)
T ss_dssp             TTCEEEEESC-C--HHHHHHHHHHHHHCCSEEEEECSSHHHHHHHHHHHTCEEC-CGGGHHHHHHTCSEEEECCSSSSCC
T ss_pred             ccCeEEEECC-C--HHHHHHHHHHHhcCCcEEEEEcCcHHHHHHHHHhhhcccc-cchhHHHHhccCCEEEEecCCCCcc
Confidence            6889999999 7  999999999999998 5777  888999999998664322 2222222 2 34434444443   4


Q ss_pred             CChhhhhcC------CCCceeecccccCCc
Q 006623          534 LTGKEQARA------PKGTIFIPYTQIPPR  557 (638)
Q Consensus       534 ~~~~~q~~a------~~G~~f~~~~~~~~~  557 (638)
                      ++.++.+.+      .++.+|+|.+ +|+.
T Consensus        99 i~~~~i~~~~~~r~~~~~~~iiDla-vPr~  127 (159)
T d1gpja2          99 IHVDDVREALRKRDRRSPILIIDIA-NPRD  127 (159)
T ss_dssp             BCHHHHHHHHHHCSSCCCEEEEECC-SSCS
T ss_pred             ccHhhhHHHHHhcccCCCeEEEeec-CCCC
Confidence            788776543      3567999998 7775
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure