Citrus Sinensis ID: 006709

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630----
MATTHHSVSASATKTQLLFSSRVSNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEccEEcccHHHHHHHHHHHccEEEEEEEEccccccccccccccccccccccccEEccccEEEEEEccccccccccEEcEEEEEcHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEcccccEEEEEccccccccccccccccHHHHHHHHHHHcccEEEccHHHHHHHcccEEEEEEccEEEEEcccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHccccccccccccHHHHHHHccccccHHHHHcccccccccccccccc
cccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccEEEEEccccccccEccccEEEEEEcHHHHHHHHHcccEEEEEcccccccccEEEccHHHHHHHHHHHHcccEEEEEEccccccccccccHHccHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHcccccccccccEEcccHHHHHcHccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEHcccccccHHHHHHHHHcccHccHHHHHHHHHHHHHHHHcccEEcccHHHHHHHHcccEEEEcccEEEEEEEEccccHHcccEEEEEEEcHHHcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHcccccccHHHccHHHHHHHHHHcccHHHHHHcccccccEEEEcccc
matthhsvsasatKTQLLFSSRVsnslkpaqnlgfQLQGQILKGLCHHSIKNKERNLSKCKVFSeamggnveetynpvedEQFVKWFREAWPYLWAHRGGTFVVIISgeivsspyldpilKDIAFLHHLGIrfvlvpgthVQIDKLLSERGHEAkylgryritdSESLAAAMEAAGGIRMMIEAklspgppicnirrhgdssrwheVGVSVASGNflaakrkgvvdgvdygatgevkkVDVTRMRERLDGGCLVILsnlgysssgevlncntYEVATACALAIEADKLIciidgpildesgHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAeeditcfghsdsigsvyssqngktfsERRIATfnngvgfdngnglwsseqgfaigGQERLSRLNGYLSELAAAAFVCRrgvqrvhlldgtIGGVLLLELFkrdgmgtmvasdlyegtrtakvtdlsgiKQIIQPlvesgalvrrTDEELLKALDSFYVVEREGQIIACAALFPffkekcgevaaigvspecrgqgqgdkllglciwpllsetrydhistngfpFLRDYIEKKAASLGLDMLFLLTTRTadwfksrgfrecsieMIPEERRKRINLSRNSKYYMKKllpdtsgiivdrafr
matthhsvsasatktQLLFSSRVSNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAmggnveetynpvEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLgryritdsesLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASgnflaakrkgvvdgvdygatgevkkvdvtrmrerLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTakvtdlsgikqiiqplvesgalvrRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTadwfksrgfrecsiemipeerrkrinlsrnskyymkkllpdtsgiivdraFR
MATTHHSVSASATKTQLLFSSRVSNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATfnngvgfdngngLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR
*******************************NLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPE*****INLSRNSKYYMKKLLPDTSGIIV*****
**********************************************************************************FVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLW*************LSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGI*******
***********ATKTQLLFSSRVSNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR
************TK****F****SNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSE***********PVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTHHSVSASATKTQLLFSSRVSNSLKPAQNLGFQLQGQILKGLCHHSIKNKERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query634 2.2.26 [Sep-21-2011]
Q9CMJ6440 Amino-acid acetyltransfer yes no 0.670 0.965 0.291 1e-54
P59099442 Amino-acid acetyltransfer yes no 0.687 0.986 0.307 9e-54
P22567432 Amino-acid acetyltransfer yes no 0.668 0.981 0.307 2e-51
Q02EG0432 Amino-acid acetyltransfer yes no 0.668 0.981 0.307 2e-51
B7V594432 Amino-acid acetyltransfer yes no 0.668 0.981 0.307 2e-51
A6VDY0432 Amino-acid acetyltransfer yes no 0.668 0.981 0.307 2e-51
B0KP70432 Amino-acid acetyltransfer yes no 0.664 0.974 0.300 5e-50
Q4ZZU5432 Amino-acid acetyltransfer yes no 0.667 0.979 0.294 5e-50
P61919432 Amino-acid acetyltransfer N/A no 0.667 0.979 0.294 5e-50
P0A100432 Amino-acid acetyltransfer yes no 0.664 0.974 0.300 8e-50
>sp|Q9CMJ6|ARGA_PASMU Amino-acid acetyltransferase OS=Pasteurella multocida (strain Pm70) GN=argA PE=3 SV=1 Back     alignment and function desciption
 Score =  215 bits (547), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 249/545 (45%), Gaps = 120/545 (22%)

Query: 82  QFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHV 141
           + V WFR++ PY+  HRG TFV+++ G+ ++ P    I+ DI+ LH LGI+ VLV G   
Sbjct: 5   ELVHWFRQSTPYVNMHRGKTFVIMLDGDTIACPNFVNIINDISLLHSLGIKLVLVFGARY 64

Query: 142 QIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDS 201
           QI++LL +   E+ Y    RITD  SL    +A G +   I ++LS   P          
Sbjct: 65  QINELLQQHQIESVYHKNIRITDLTSLELVKQAVGKLNYDIASRLSLRLP---------- 114

Query: 202 SRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGY 261
              H   + V SGNF+ A+  G    VD G                           + Y
Sbjct: 115 ---HSPLIDVVSGNFVLAQPIG----VDDG---------------------------IDY 140

Query: 262 SSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQ--R 319
             SG++   NT  +        + D+   ++ GPI               A S+  +   
Sbjct: 141 QLSGKIRRINTESIQQ------QLDRDAIVLIGPI---------------APSVTGESFN 179

Query: 320 VKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGL 379
           +   EIA+     +  E +  F  +  I      +N +T S+                 L
Sbjct: 180 LPFEEIASQLAIKLKAEKLIGFSATQGI----LDENNQTISD-----------------L 218

Query: 380 WSSEQGFAIGGQERLSRLNGYLSE----LAAAAFVCRRGVQRVHLLDGTIGGVLLLELFK 435
              +    +    +L + N Y S     L AA   CR G++R HL+     G LL ELF 
Sbjct: 219 LPQDAELYLA---KLIQQNQYHSSQARFLQAAIEACRFGIKRSHLISYEEDGSLLQELFT 275

Query: 436 RDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVER 495
           RDG+GT ++ +  E  R A V+D+  + ++I+PL + G LV+R+ E+L   ++ + +++R
Sbjct: 276 RDGVGTQLSMEHSETIRLATVSDIPALLELIRPLEQQGILVKRSREQLEMEINQYTIIDR 335

Query: 496 EGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNG 555
           +G IIACAAL  +  EK  E+A + V P+ R   +GD LL                    
Sbjct: 336 DGVIIACAALNCYADEKMAEMACVAVHPDYRNSSRGDILL-------------------- 375

Query: 556 FPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKY 615
                + I+K+A  LG++ LF+LTTRT  WF+ RGF+   I  +P+++R+  N  R SK 
Sbjct: 376 -----EAIQKRAKQLGIEKLFVLTTRTVHWFQERGFQLAEIADLPDKKRQHYNYQRRSKI 430

Query: 616 YMKKL 620
            ++ L
Sbjct: 431 LIQAL 435

Pasteurella multocida (strain Pm70) (taxid: 272843)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|P59099|ARGA_BUCAP Amino-acid acetyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|P22567|ARGA_PSEAE Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argA PE=1 SV=2 Back     alignment and function description
>sp|Q02EG0|ARGA_PSEAB Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|B7V594|ARGA_PSEA8 Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|A6VDY0|ARGA_PSEA7 Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|B0KP70|ARGA_PSEPG Amino-acid acetyltransferase OS=Pseudomonas putida (strain GB-1) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|Q4ZZU5|ARGA_PSEU2 Amino-acid acetyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argA PE=3 SV=1 Back     alignment and function description
>sp|P61919|ARGA_PSESY Amino-acid acetyltransferase OS=Pseudomonas syringae pv. syringae GN=argA PE=3 SV=1 Back     alignment and function description
>sp|P0A100|ARGA_PSEPU Amino-acid acetyltransferase OS=Pseudomonas putida GN=argA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query634
224095037560 predicted protein [Populus trichocarpa] 0.867 0.982 0.783 0.0
356565491565 PREDICTED: amino-acid acetyltransferase- 0.864 0.969 0.752 0.0
356540624607 PREDICTED: amino-acid acetyltransferase- 0.927 0.968 0.707 0.0
356514348617 PREDICTED: LOW QUALITY PROTEIN: amino-ac 0.864 0.888 0.728 0.0
255568615705 N-acetyltransferase, putative [Ricinus c 0.837 0.753 0.730 0.0
356496999605 PREDICTED: amino-acid acetyltransferase- 0.828 0.867 0.756 0.0
297821519609 hypothetical protein ARALYDRAFT_481154 [ 0.862 0.898 0.715 0.0
297798106611 hypothetical protein ARALYDRAFT_490852 [ 0.943 0.978 0.677 0.0
42573209613 N-acetyl-l-glutamate synthase 2 [Arabido 0.936 0.969 0.673 0.0
30681866609 amino-acid N-acetyltransferase [Arabidop 0.862 0.898 0.712 0.0
>gi|224095037|ref|XP_002310336.1| predicted protein [Populus trichocarpa] gi|222853239|gb|EEE90786.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/581 (78%), Positives = 500/581 (86%), Gaps = 31/581 (5%)

Query: 53  KERNLSKCKVFSEAMGGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVS 112
           +  + S+ KVF EA  G++EE YN VED+QFVKWFREAWPYLWAHRG TFVVIISGE VS
Sbjct: 10  RTNSTSRRKVFGEAESGSIEEGYNSVEDKQFVKWFREAWPYLWAHRGSTFVVIISGETVS 69

Query: 113 SPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAM 172
           SP+LD ILK   FLHHLGI+FVLVPGTHVQI+ LL+ERGHE K++G+YRITDSE+LAA+M
Sbjct: 70  SPFLDSILK-ATFLHHLGIKFVLVPGTHVQINNLLAERGHEPKHVGQYRITDSEALAASM 128

Query: 173 EAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGA 232
           EAAG IRMMIEAKLSPGP ICNIRRHGDSSRWH+VGVSVASGNFLAAKR+GVVDGVD+GA
Sbjct: 129 EAAGKIRMMIEAKLSPGPSICNIRRHGDSSRWHDVGVSVASGNFLAAKRRGVVDGVDFGA 188

Query: 233 TGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICII 292
           TGEVKKVDVTRMRERLDGGC+V+LSNLGYSSSGEVLNCNTYEVATACALAI ADKLIC+I
Sbjct: 189 TGEVKKVDVTRMRERLDGGCIVVLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICVI 248

Query: 293 DGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYS 352
           DGPILDESGHLIRFLTL+EAD LIR+R KQSEIAA+YVKAV +ED+T   H+DSIG + S
Sbjct: 249 DGPILDESGHLIRFLTLEEADMLIRKRAKQSEIAAHYVKAVGDEDLTFLEHNDSIGILAS 308

Query: 353 SQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCR 412
           S NGK  S R  ATF NGVGFDNGNG     QGFAIGG+E  SRLNGYLSELAAAAFVC+
Sbjct: 309 SLNGKALSGRHSATFQNGVGFDNGNG-----QGFAIGGEELQSRLNGYLSELAAAAFVCK 363

Query: 413 RGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVES 472
            GVQRVHLLDGTI GVLLLELFKRDGMGTMVASDLYEGTR A+VTDL+GI+QIIQPL ES
Sbjct: 364 GGVQRVHLLDGTISGVLLLELFKRDGMGTMVASDLYEGTRMARVTDLAGIRQIIQPLEES 423

Query: 473 GALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGD 532
           G LVRRTDEELLKAL ++ VVEREGQIIACAALFPFF+EKCGEVAAI VSPECRGQGQGD
Sbjct: 424 GTLVRRTDEELLKALYAYVVVEREGQIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGD 483

Query: 533 KLLGLCIWPLLSETRYDHISTNGFPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFR 592
           KLL                         D+IE++A+SLGL+ LFLLTTRTADWF  RGF 
Sbjct: 484 KLL-------------------------DFIERRASSLGLETLFLLTTRTADWFNRRGFS 518

Query: 593 ECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAF 633
           ECSI++IPEERRK+INLSRNSKYY KKLLPDTSGI V+RAF
Sbjct: 519 ECSIQLIPEERRKKINLSRNSKYYTKKLLPDTSGISVNRAF 559

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356565491|ref|XP_003550973.1| PREDICTED: amino-acid acetyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|356540624|ref|XP_003538787.1| PREDICTED: amino-acid acetyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|356514348|ref|XP_003525868.1| PREDICTED: LOW QUALITY PROTEIN: amino-acid acetyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|255568615|ref|XP_002525281.1| N-acetyltransferase, putative [Ricinus communis] gi|223535439|gb|EEF37109.1| N-acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356496999|ref|XP_003517352.1| PREDICTED: amino-acid acetyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|297821519|ref|XP_002878642.1| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata] gi|297324481|gb|EFH54901.1| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297798106|ref|XP_002866937.1| hypothetical protein ARALYDRAFT_490852 [Arabidopsis lyrata subsp. lyrata] gi|297312773|gb|EFH43196.1| hypothetical protein ARALYDRAFT_490852 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42573209|ref|NP_974701.1| N-acetyl-l-glutamate synthase 2 [Arabidopsis thaliana] gi|209414522|gb|ACI46501.1| At4g37670 [Arabidopsis thaliana] gi|332661422|gb|AEE86822.1| N-acetyl-l-glutamate synthase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30681866|ref|NP_179875.2| amino-acid N-acetyltransferase [Arabidopsis thaliana] gi|28393691|gb|AAO42258.1| putative amino acid acetyltransferase [Arabidopsis thaliana] gi|29824347|gb|AAP04134.1| putative amino acid acetyltransferase [Arabidopsis thaliana] gi|330252278|gb|AEC07372.1| amino-acid N-acetyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query634
TAIR|locus:2120130613 NAGS2 "N-acetyl-l-glutamate sy 0.752 0.778 0.717 8.4e-210
TAIR|locus:2059165609 NAGS1 "N-acetyl-l-glutamate sy 0.746 0.776 0.713 1.2e-208
UNIPROTKB|P22567432 argA "Amino-acid acetyltransfe 0.381 0.560 0.381 1.8e-81
TIGR_CMR|CPS_0465436 CPS_0465 "amino-acid N-acetylt 0.364 0.529 0.394 1.9e-77
UNIPROTKB|P0A6C5443 argA [Escherichia coli K-12 (t 0.378 0.541 0.329 2.5e-73
TIGR_CMR|SO_4245445 SO_4245 "amino-acid acetyltran 0.372 0.530 0.353 2e-68
UNIPROTKB|Q9KPQ0445 argA "Amino-acid acetyltransfe 0.362 0.516 0.359 2.5e-66
TIGR_CMR|VC_2316445 VC_2316 "N-acetylglutamate syn 0.362 0.516 0.359 2.5e-66
TIGR_CMR|CHY_2263294 CHY_2263 "acetylglutamate kina 0.347 0.748 0.270 1.5e-18
TIGR_CMR|GSU_0150292 GSU_0150 "acetylglutamate kina 0.340 0.739 0.277 5.4e-15
TAIR|locus:2120130 NAGS2 "N-acetyl-l-glutamate synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1750 (621.1 bits), Expect = 8.4e-210, Sum P(2) = 8.4e-210
 Identities = 348/485 (71%), Positives = 400/485 (82%)

Query:    58 SKCKVFSEAM--GGNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPY 115
             +KC +F  A+   G+VE  + PV+D+QFV+WFREAWPYLWAHRG TFVVIISGEI++   
Sbjct:    58 AKCNMFDYAVTAAGDVEAEH-PVDDKQFVRWFREAWPYLWAHRGCTFVVIISGEIIAGSS 116

Query:   116 LDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAA 175
              D ILKDIAFLHHLGIRFVLVPGT  QID+LL+ERG EA Y+GRYR+TD+ SL AA EAA
Sbjct:   117 CDAILKDIAFLHHLGIRFVLVPGTQEQIDQLLAERGREATYVGRYRVTDAASLQAAKEAA 176

Query:   176 GGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGE 235
             G I +M+EAKLSPGP ICNIRRHGD SR H++GV V +GNF AAKR+GVVDGVD+GATGE
Sbjct:   177 GAISVMLEAKLSPGPSICNIRRHGDRSRLHDIGVRVDTGNFFAAKRRGVVDGVDFGATGE 236

Query:   236 VKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGP 295
             VKK+DV R+ ERLDGG +V+L NLG+SSSGEVLNCNTYEVATACALAI ADKLICI+DGP
Sbjct:   237 VKKIDVDRICERLDGGSVVLLRNLGHSSSGEVLNCNTYEVATACALAIGADKLICIMDGP 296

Query:   296 ILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITC-FGHSDSIGSVYSSQ 354
             ILDESGHLI FLTLQEAD L+R+R +QS+IAANYVKAV +  +      +++ G++ S+Q
Sbjct:   297 ILDESGHLIHFLTLQEADMLVRKRAQQSDIAANYVKAVGDGSMAYPEPPNNTNGNITSAQ 356

Query:   355 NGKTFS----ERRIATXXXXXXXXXXXXLWSSEQGFAIGGQERLSRLNGYLSELAAAAFV 410
             NG+  S                      LW  EQGFAIGG+ERLSRLNGYLSELAAAAFV
Sbjct:   357 NGRAVSFWGNGNHTPIFQNGVGFDNGNGLWPCEQGFAIGGEERLSRLNGYLSELAAAAFV 416

Query:   411 CRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLV 470
             CR GV+RVHLLDGTI GVLLLELFKRDGMGTMVASD+YEGTR A+V DL+GI+ II+PL 
Sbjct:   417 CRGGVKRVHLLDGTISGVLLLELFKRDGMGTMVASDVYEGTRDARVEDLAGIRHIIKPLE 476

Query:   471 ESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQ 530
             ESG LVRRTDEELL+ALDSF VVEREGQIIACAALFPFFK+KCGEVAAI V+ +CRGQGQ
Sbjct:   477 ESGILVRRTDEELLRALDSFVVVEREGQIIACAALFPFFKDKCGEVAAIAVASDCRGQGQ 536

Query:   531 GDKLL 535
             GDKLL
Sbjct:   537 GDKLL 541
GO:0004042 "acetyl-CoA:L-glutamate N-acetyltransferase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=IEA
GO:0006526 "arginine biosynthetic process" evidence=IEA;ISS
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
TAIR|locus:2059165 NAGS1 "N-acetyl-l-glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P22567 argA "Amino-acid acetyltransferase" [Pseudomonas aeruginosa PAO1 (taxid:208964)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0465 CPS_0465 "amino-acid N-acetyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6C5 argA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4245 SO_4245 "amino-acid acetyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPQ0 argA "Amino-acid acetyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2316 VC_2316 "N-acetylglutamate synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2263 CHY_2263 "acetylglutamate kinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0150 GSU_0150 "acetylglutamate kinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.766
4th Layer2.7.2.8LOW CONFIDENCE prediction!
3rd Layer2.7.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query634
PLN02825515 PLN02825, PLN02825, amino-acid N-acetyltransferase 0.0
cd04237280 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta 1e-117
PRK05279441 PRK05279, PRK05279, N-acetylglutamate synthase; Va 3e-77
PRK05279441 PRK05279, PRK05279, N-acetylglutamate synthase; Va 3e-67
TIGR01890429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran 2e-57
TIGR01890429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran 4e-54
COG0548265 COG0548, ArgB, Acetylglutamate kinase [Amino acid 8e-46
COG1246153 COG1246, ArgA, N-acetylglutamate synthase and rela 2e-33
cd04238256 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L- 2e-27
PRK00942283 PRK00942, PRK00942, acetylglutamate kinase; Provis 5e-27
TIGR00761231 TIGR00761, argB, acetylglutamate kinase 7e-25
cd04250279 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutam 2e-23
PLN02512309 PLN02512, PLN02512, acetylglutamate kinase 3e-19
cd04252248 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acety 2e-17
CHL00202284 CHL00202, argB, acetylglutamate kinase; Provisiona 3e-17
PRK07757152 PRK07757, PRK07757, acetyltransferase; Provisional 4e-17
cd04237280 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta 6e-17
PRK14058268 PRK14058, PRK14058, acetylglutamate/acetylaminoadi 5e-16
cd04251257 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glut 1e-13
PRK12308614 PRK12308, PRK12308, bifunctional argininosuccinate 2e-12
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 3e-12
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily 3e-12
PRK07922169 PRK07922, PRK07922, N-acetylglutamate synthase; Va 4e-10
cd04249252 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glut 1e-08
COG0548265 COG0548, ArgB, Acetylglutamate kinase [Amino acid 8e-08
pfam1350879 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT 5e-07
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 2e-06
PRK04531398 PRK04531, PRK04531, acetylglutamate kinase; Provis 4e-06
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 2e-05
PRK00942283 PRK00942, PRK00942, acetylglutamate kinase; Provis 5e-05
cd04238256 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L- 6e-05
cd04250279 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutam 9e-05
pfam13527127 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT 0.001
>gnl|CDD|215441 PLN02825, PLN02825, amino-acid N-acetyltransferase Back     alignment and domain information 
 Score =  975 bits (2522), Expect = 0.0
 Identities = 408/541 (75%), Positives = 454/541 (83%), Gaps = 28/541 (5%)

Query: 83  FVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQ 142
           FV+WFREAWPY+  HRG TFVV+ISGE+V+ P+LD IL+DI+ LH LGI+FVLVPGTHVQ
Sbjct: 1   FVRWFREAWPYIQGHRGSTFVVVISGEVVAGPHLDNILQDISLLHGLGIKFVLVPGTHVQ 60

Query: 143 IDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSS 202
           IDKLL+ERG E KY+G YRITDS +L A+MEAAG IR+MIEAKLSPGP I N+RRHGD+S
Sbjct: 61  IDKLLAERGREPKYVGAYRITDSAALQASMEAAGKIRVMIEAKLSPGPSIPNLRRHGDNS 120

Query: 203 RWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNLGYS 262
           RWHEVGVSVASGNFLAAKR+GVV+GVD+GATGEVKK+DV+R++ERLD  C+V+LSNLGYS
Sbjct: 121 RWHEVGVSVASGNFLAAKRRGVVNGVDFGATGEVKKIDVSRIKERLDSNCIVLLSNLGYS 180

Query: 263 SSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQ 322
           SSGEVLNCNTYEVATACALAI ADKLICI+DGPILDE+G LIRF+TL+EAD LIR+R KQ
Sbjct: 181 SSGEVLNCNTYEVATACALAIGADKLICIVDGPILDENGRLIRFMTLEEADMLIRKRAKQ 240

Query: 323 SEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIAT--FNNGVGFDNGNGLW 380
           SEIAANYVKAV  ED +     DS+ +   + NG+ F     AT  F NGVGFDNGNGL 
Sbjct: 241 SEIAANYVKAVGGEDYSYSLGLDSVNTTPFNNNGRGFWGSGSATDSFQNGVGFDNGNGL- 299

Query: 381 SSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMG 440
           S EQGFAIGG+ERLSRLNGYLSELAAAAFVCR GVQRVHLLDGTI GVLLLELF RDGMG
Sbjct: 300 SGEQGFAIGGEERLSRLNGYLSELAAAAFVCRGGVQRVHLLDGTIEGVLLLELFTRDGMG 359

Query: 441 TMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQII 500
           TM+ASD+YEGTR A+V DL+GI+QII+PL ESG LVRRTDEELL+ALDSF VVEREG II
Sbjct: 360 TMIASDMYEGTRMARVEDLAGIRQIIRPLEESGILVRRTDEELLRALDSFVVVEREGSII 419

Query: 501 ACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFLR 560
           ACAALFPFF+EKCGEVAAI VSPECRGQGQGDKLL                         
Sbjct: 420 ACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLL------------------------- 454

Query: 561 DYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKL 620
           DYIEKKAASLGL+ LFLLTTRTADWF  RGF ECSIE +PE RRKRINLSR SKYYMKKL
Sbjct: 455 DYIEKKAASLGLEKLFLLTTRTADWFVRRGFSECSIESLPEARRKRINLSRGSKYYMKKL 514

Query: 621 L 621
           L
Sbjct: 515 L 515

Length = 515
>gnl|CDD|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>gnl|CDD|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated Back     alignment and domain information
>gnl|CDD|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated Back     alignment and domain information
>gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>gnl|CDD|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233118 TIGR00761, argB, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|239783 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|178128 PLN02512, PLN02512, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|239785 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>gnl|CDD|133644 CHL00202, argB, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|236088 PRK07757, PRK07757, acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>gnl|CDD|237599 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239784 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>gnl|CDD|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|236132 PRK07922, PRK07922, N-acetylglutamate synthase; Validated Back     alignment and domain information
>gnl|CDD|239782 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|235306 PRK04531, PRK04531, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>gnl|CDD|239783 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 634
PLN02825515 amino-acid N-acetyltransferase 100.0
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 100.0
PRK05279441 N-acetylglutamate synthase; Validated 100.0
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport 100.0
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) 100.0
CHL00202284 argB acetylglutamate kinase; Provisional 100.0
PLN02512309 acetylglutamate kinase 100.0
PRK00942283 acetylglutamate kinase; Provisional 100.0
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase 100.0
KOG2436520 consensus Acetylglutamate kinase/acetylglutamate s 100.0
PRK04531398 acetylglutamate kinase; Provisional 100.0
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA 100.0
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam 100.0
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate 100.0
PRK14058268 acetylglutamate/acetylaminoadipate kinase; Provisi 100.0
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina 100.0
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina 100.0
PRK12352316 putative carbamate kinase; Reviewed 100.0
TIGR00761231 argB acetylglutamate kinase. This model describes 100.0
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fo 100.0
PRK12353314 putative amino acid kinase; Reviewed 99.98
PRK12686312 carbamate kinase; Reviewed 99.97
PRK12454313 carbamate kinase-like carbamoyl phosphate syntheta 99.97
COG0263369 ProB Glutamate 5-kinase [Amino acid transport and 99.97
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalyti 99.97
TIGR00746310 arcC carbamate kinase. The seed alignment for this 99.97
PF00696242 AA_kinase: Amino acid kinase family Match to Gluta 99.96
PRK09411297 carbamate kinase; Reviewed 99.96
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot 99.96
PRK13402368 gamma-glutamyl kinase; Provisional 99.96
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase 99.96
PRK05429372 gamma-glutamyl kinase; Provisional 99.96
PTZ00489264 glutamate 5-kinase; Provisional 99.96
PRK12354307 carbamate kinase; Reviewed 99.96
COG0549312 ArcC Carbamate kinase [Amino acid transport and me 99.95
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K 99.95
PRK12314266 gamma-glutamyl kinase; Provisional 99.95
TIGR01027363 proB glutamate 5-kinase. Bacterial ProB proteins h 99.94
KOG1154285 consensus Gamma-glutamyl kinase [Amino acid transp 99.94
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 99.94
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 99.94
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase 99.93
COG1608252 Predicted archaeal kinase [General function predic 99.93
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.92
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 99.91
PRK00358231 pyrH uridylate kinase; Provisional 99.9
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 99.9
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik 99.9
PRK08210403 aspartate kinase I; Reviewed 99.9
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.89
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th 99.89
PRK14558231 pyrH uridylate kinase; Provisional 99.88
PRK06635404 aspartate kinase; Reviewed 99.88
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi 99.88
PRK08841392 aspartate kinase; Validated 99.87
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 99.86
TIGR02075233 pyrH_bact uridylate kinase. This protein, also cal 99.86
TIGR02076221 pyrH_arch uridylate kinase, putative. This family 99.85
PRK07431587 aspartate kinase; Provisional 99.85
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP 99.85
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin 99.81
PRK14557247 pyrH uridylate kinase; Provisional 99.79
TIGR00657441 asp_kinases aspartate kinase. The Lys-sensitive en 99.79
PRK14556249 pyrH uridylate kinase; Provisional 99.75
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina 99.67
PRK06291465 aspartate kinase; Provisional 99.63
PRK07757152 acetyltransferase; Provisional 99.59
PRK08373341 aspartate kinase; Validated 99.59
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.58
COG0528238 PyrH Uridylate kinase [Nucleotide transport and me 99.58
COG0527447 LysC Aspartokinases [Amino acid transport and meta 99.54
PTZ00330147 acetyltransferase; Provisional 99.52
PRK07922169 N-acetylglutamate synthase; Validated 99.51
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.51
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super 99.47
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.45
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa 99.42
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.41
TIGR02078327 AspKin_pair Pyrococcus aspartate kinase subunit, p 99.4
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina 99.4
PHA00673154 acetyltransferase domain containing protein 99.39
PRK03624140 putative acetyltransferase; Provisional 99.38
PRK09831147 putative acyltransferase; Provisional 99.37
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.37
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki 99.35
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 99.34
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.33
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.33
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.31
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.31
COG1247169 Sortase and related acyltransferases [Cell envelop 99.3
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.29
PRK09084448 aspartate kinase III; Validated 99.29
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.29
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.29
PRK05925440 aspartate kinase; Provisional 99.28
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 99.28
PRK10140162 putative acetyltransferase YhhY; Provisional 99.28
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.23
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki 99.23
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.2
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.2
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 99.18
PRK09034454 aspartate kinase; Reviewed 99.18
COG0456177 RimI Acetyltransferases [General function predicti 99.17
PRK10314153 putative acyltransferase; Provisional 99.15
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.14
PRK10514145 putative acetyltransferase; Provisional 99.14
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa 99.13
KOG3139165 consensus N-acetyltransferase [General function pr 99.13
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 99.09
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.08
PLN02551521 aspartokinase 99.07
COG3153171 Predicted acetyltransferase [General function pred 99.05
PRK01346 411 hypothetical protein; Provisional 99.03
COG2054212 Uncharacterized archaeal kinase related to asparto 99.0
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.0
PRK10562145 putative acetyltransferase; Provisional 98.99
PHA01807153 hypothetical protein 98.99
PRK13688156 hypothetical protein; Provisional 98.99
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 98.97
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.96
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 98.95
PRK15130186 spermidine N1-acetyltransferase; Provisional 98.94
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.94
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 98.86
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 98.83
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.81
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 98.75
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 98.58
KOG3397225 consensus Acetyltransferases [General function pre 98.38
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 98.31
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.31
COG2153155 ElaA Predicted acyltransferase [General function p 98.31
KOG3138187 consensus Predicted N-acetyltransferase [General f 98.25
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 98.23
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 98.18
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 98.17
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 98.08
COG3393268 Predicted acetyltransferase [General function pred 98.06
COG3053 352 CitC Citrate lyase synthetase [Energy production a 98.01
PRK09181475 aspartate kinase; Validated 97.92
COG1670187 RimL Acetyltransferases, including N-acetylases of 97.92
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 97.91
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S 97.87
COG3981174 Predicted acetyltransferase [General function pred 97.63
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 97.57
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 97.39
COG238899 Predicted acetyltransferase [General function pred 97.26
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 97.22
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 97.21
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 97.02
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 96.9
PF04958 342 AstA: Arginine N-succinyltransferase beta subunit; 96.76
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 96.73
KOG0456559 consensus Aspartate kinase [Amino acid transport a 96.69
COG4552 389 Eis Predicted acetyltransferase involved in intrac 96.41
TIGR03244336 arg_catab_AstA arginine N-succinyltransferase. In 96.35
TIGR03245336 arg_AOST_alph arginine/ornithine succinyltransfera 96.18
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 96.16
PRK10456 344 arginine succinyltransferase; Provisional 96.12
TIGR03243335 arg_catab_AOST arginine and ornithine succinyltran 96.08
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 95.75
COG5630495 ARG2 Acetylglutamate synthase [Amino acid transpor 95.66
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 95.63
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 95.23
PRK13834207 putative autoinducer synthesis protein; Provisiona 94.83
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 94.61
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 94.39
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 93.29
COG3138336 AstA Arginine/ornithine N-succinyltransferase beta 92.8
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 92.31
COG5628143 Predicted acetyltransferase [General function pred 91.61
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 91.08
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 89.6
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 89.15
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 87.65
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 87.37
PF02799190 NMT_C: Myristoyl-CoA:protein N-myristoyltransferas 84.55
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 84.54
KOG2779421 consensus N-myristoyl transferase [Lipid transport 82.89
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 82.65
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 81.04
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information 
Probab=100.00  E-value=2.4e-98  Score=829.46  Aligned_cols=508  Identities=79%  Similarity=1.241  Sum_probs=471.7

Q ss_pred             HHHHHHHhhhHHHhhcCCeEEEEECCccCCCCChHHHHHHHHHHHhCCCeEEEEeCchHHHHHHHHHcCCcccccCCccC
Q 006709           83 FVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRI  162 (634)
Q Consensus        83 ~v~~~r~a~pYi~~~r~k~iVIKLGGsvL~~~~l~~la~dIa~L~~~G~kvVLVHGGG~~I~~~l~~lg~~~~~~~G~Rv  162 (634)
                      ||+|||+|+|||++||+||||||+||+++.++.+++++.||+.|+..|+++||||||||||+..++++|++++|++|+|+
T Consensus         1 ~v~~fr~a~pYI~~~rgktfVIk~gG~~l~~~~~~~l~~DialL~~lGi~~VlVHGggpqI~~~l~~~gi~~~f~~G~RV   80 (515)
T PLN02825          1 FVRWFREAWPYIQGHRGSTFVVVISGEVVAGPHLDNILQDISLLHGLGIKFVLVPGTHVQIDKLLAERGREPKYVGAYRI   80 (515)
T ss_pred             ChhHHHhhhHHHHHHCCCEEEEEECchhhcCchHHHHHHHHHHHHHCCCCEEEEcCCCHHHHHHHHHcCCCceeeCCccc
Confidence            68999999999999999999999999999887899999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHhHHHHHHHHhcCCCCchhhHHhcCCCCcceeEEeeccCCceeeeeecccccCccccccceEEEecHH
Q 006709          163 TDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVT  242 (634)
Q Consensus       163 T~~~~l~~~~~a~G~in~~Lv~~L~~~~~~~~L~~~Gi~~~~~av~l~~~dg~~l~ak~~g~~~g~d~g~~G~v~~vd~~  242 (634)
                      |++++|+++++++|++|..|++.|++|+++..|+++|+++|++.+++++.||||++++|+|+++++||||+|+|+.||.+
T Consensus        81 Td~~~L~~~~~~~G~v~~~i~a~Ls~~~~v~~l~~~G~~a~~~~~gl~~~~Gn~v~a~~~gv~dgvD~g~vG~V~~Vd~~  160 (515)
T PLN02825         81 TDSAALQASMEAAGKIRVMIEAKLSPGPSIPNLRRHGDNSRWHEVGVSVASGNFLAAKRRGVVNGVDFGATGEVKKIDVS  160 (515)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHhhccccchhHHHhcCCCCccccCceEeccCcEEEEEECCCCcCccccceeeEEEEcHH
Confidence            99999999999999999999999999999999999999988888999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCcEEEEcCCccCCCCceeeechHHHHHHHHHHcCCCEEEEeecccccCCCCccccccCHHHHHHHHHhhchh
Q 006709          243 RMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQ  322 (634)
Q Consensus       243 ~I~~LLd~G~IPVv~~v~~~~~Gei~nid~D~lAa~LA~aL~AdkLI~LTDVdgld~~gklI~~ls~~e~~~li~~~~~~  322 (634)
                      .|+.+|++|.|||++|++++.+|+++|+|+|++|+++|.+|+||||||+||+++++.++++|++++.+|++.+++++.+|
T Consensus       161 ~i~~~L~~g~Ipvisplg~s~~Ge~~NinaD~vA~avA~aL~A~KLI~ltd~~~~~~~g~li~~l~~~e~~~li~~~~~~  240 (515)
T PLN02825        161 RIKERLDSNCIVLLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICIVDGPILDENGRLIRFMTLEEADMLIRKRAKQ  240 (515)
T ss_pred             HHHHHHhCCCeEEECCceECCCCCEEeeCHHHHHHHHHHHcCCCeEEEEeCcceecCCCCCcCcCCHHHHHHHHHhhhhc
Confidence            99999999999999999999999999999999999999999999999999999888899999999999999999888889


Q ss_pred             hhhHHHHHHhhhhccccccCCCCCCcccccCCCCCccccc-------hhccccCCcccCCCCCCcccccccccCcccccc
Q 006709          323 SEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSER-------RIATFNNGVGFDNGNGLWSSEQGFAIGGQERLS  395 (634)
Q Consensus       323 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~G~G~~~~~~~~~~GG~~~~~  395 (634)
                      |+|+|++.|||++++.++...-..     .+..|.++.+.       ....|.++++|+++.| .+.+|+|++||+|++|
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~  314 (515)
T PLN02825        241 SEIAANYVKAVGGEDYSYSLGLDS-----VNTTPFNNNGRGFWGSGSATDSFQNGVGFDNGNG-LSGEQGFAIGGEERLS  314 (515)
T ss_pred             chhhhhhhhhcccccccccccccc-----ccccccccccccccccccccccccccccccCccc-ccccccccccchhhch
Confidence            999999999999986553221100     00112222211       2223566666666655 3678999999999999


Q ss_pred             cccCCHHHHHHHHHHHHcCCceEEEccCCcchhHHHHHHhhcCCccccccccccccccCccchHHHHHHhHHHHHHcccC
Q 006709          396 RLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGAL  475 (634)
Q Consensus       396 ~~~~m~~Kl~AA~~a~~~Gv~rv~I~~g~~~~~ll~el~~~~g~GT~I~~D~Ye~iR~a~~~D~~~i~~l~~~~~~~~~~  475 (634)
                      +...+++||.+|.+||++||+|+||+|++.+|+||+||||+||+||+|++|+|+.||+|+.+|++.|.+|++++.+.+..
T Consensus       315 ~~~~~~~~l~~a~~a~~~gv~r~hl~~~~~~gall~elft~dg~gt~i~~~~~e~IR~At~eDi~~I~~Li~~lee~g~l  394 (515)
T PLN02825        315 RLNGYLSELAAAAFVCRGGVQRVHLLDGTIEGVLLLELFTRDGMGTMIASDMYEGTRMARVEDLAGIRQIIRPLEESGIL  394 (515)
T ss_pred             hhhhHHHHHHHHHHHHHcCCCeEEeccCCCCchHHHHhhccCCceeEeccChHhhheeCCHHHHHHHHHHHHHHHHcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998888


Q ss_pred             ccCCHHHHHhhcCcEEEEEECCeEEEEEEEeeecCCCeEEEEEEEECCCCcCCCHHHHHHhhhcccccccccccccccCC
Q 006709          476 VRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNG  555 (634)
Q Consensus       476 ~~~~~~~~~~~l~~~~V~~~~g~iiG~~~l~~~~~~~~~ei~~l~V~p~~rgqGiG~~Ll~~~i~~~~~~~~~~~~~~~~  555 (634)
                      ..++.+.+...+..|+|++.||+||||+.++|+..+..+||.+++|+|+|||+|+|++||                    
T Consensus       395 v~rs~e~le~ei~~f~V~e~Dg~IVG~aal~~~~~~~~aEI~~laV~P~yRGkGiG~~LL--------------------  454 (515)
T PLN02825        395 VRRTDEELLRALDSFVVVEREGSIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLL--------------------  454 (515)
T ss_pred             cCCCHHHHHhcCCcEEEEEECCEEEEEEEEEeecCCCcEEEEEEEECHHHcCCCHHHHHH--------------------
Confidence            888999999999999999999999999999988777889999999999999999999999                    


Q ss_pred             CcchHHHHHHHHHHcCCcEEEEecHHhHHHHHhCCCeecccccchhHhhhhccCCCCceEEEeecC
Q 006709          556 FPFLRDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLL  621 (634)
Q Consensus       556 ~~~~~~~i~~~a~~~g~~~l~l~t~~a~~~Y~k~GF~~~~~~~~~~~~~~~~~~~~~s~~~~k~l~  621 (634)
                           +++++.|+++|++.+++.++++.+||+++||++++...+|+.+++.||+.||||+|||+|.
T Consensus       455 -----~~le~~Ar~~G~~~L~Lltt~a~~fY~k~GF~~~~~~~lp~~~~~~yn~~r~sk~~~k~l~  515 (515)
T PLN02825        455 -----DYIEKKAASLGLEKLFLLTTRTADWFVRRGFSECSIESLPEARRKRINLSRGSKYYMKKLL  515 (515)
T ss_pred             -----HHHHHHHHHCCCCEEEEEeCcHHHHHHHCCCEEeChhhCCHHHHhhcCccCCcEEEEEecC
Confidence                 9999999999999999999999999999999999999999999999999999999999984

>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>PLN02512 acetylglutamate kinase Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>PRK12353 putative amino acid kinase; Reviewed Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>TIGR00746 arcC carbamate kinase Back     alignment and domain information
>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PTZ00489 glutamate 5-kinase; Provisional Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK14558 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>PRK14557 pyrH uridylate kinase; Provisional Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>PRK14556 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query634
2r8v_A456 Native Structure Of N-Acetylglutamate Synthase From 3e-30
2r8v_A456 Native Structure Of N-Acetylglutamate Synthase From 3e-30
2r98_A456 Crystal Structure Of N-Acetylglutamate Synthase (Se 3e-30
3e0k_A150 Crystal Structure Of C-Termianl Domain Of N-Acetylg 3e-21
2buf_A300 Arginine Feed-Back Inhibitable Acetylglutamate Kina 5e-14
2bty_A282 Acetylglutamate Kinase From Thermotoga Maritima Com 2e-12
2rd5_A298 Structural Basis For The Regulation Of N-Acetylglut 1e-11
2jj4_A321 The Complex Of Pii And Acetylglutamate Kinase From 4e-11
3zzf_A307 Crystal Structure Of The Amino Acid Kinase Domain F 8e-11
3zzi_A464 Crystal Structure Of A Tetrameric Acetylglutamate K 1e-10
3s6k_A467 Crystal Structure Of Xcnags Length = 467 1e-09
2ap9_A299 Crystal Structure Of Acetylglutamate Kinase From My 2e-07
3l86_A279 The Crystal Structure Of Smu.665 From Streptococcus 6e-04
>pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 125/246 (50%), Gaps = 15/246 (6%)
Query: 81  EQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTH 140
           + FV  FREA PY+   RG T V  I G ++    L+ +  DI  L  LGIR VL+ G +
Sbjct: 25  DSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAADIGLLSQLGIRLVLIHGAY 84
Query: 141 VQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGD 200
             +D+L + +G    Y    R+TD  SL  A + AG +R   EA L      C     G 
Sbjct: 85  HFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRSRFEAAL------C-----GS 133
Query: 201 SSRWHEV-GVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERLDGGCLVILSNL 259
            S +     V + SGNFL A+  GV+DG D    G ++K D   +R +LD G +V +  L
Sbjct: 134 VSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLDAGNIVWMPPL 193
Query: 260 GYSSSGEVLNCNTYEVATACALAIEADKLICII--DGPILDESGHLIRFLTLQEADSLIR 317
           G+S  G+  N +  + A + A++++A+KL+ +   DG I    G L   L+ QEA SL  
Sbjct: 194 GHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDG-ISRPDGTLAETLSAQEAQSLAE 252
Query: 318 QRVKQS 323
               ++
Sbjct: 253 HAASET 258
>pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 Back     alignment and structure
>pdb|3E0K|A Chain A, Crystal Structure Of C-Termianl Domain Of N-Acetylglutamate Synthase From Vibrio Parahaemolyticus Length = 150 Back     alignment and structure
>pdb|2BUF|A Chain A, Arginine Feed-Back Inhibitable Acetylglutamate Kinase Length = 300 Back     alignment and structure
>pdb|2BTY|A Chain A, Acetylglutamate Kinase From Thermotoga Maritima Complexed With Its Inhibitor Arginine Length = 282 Back     alignment and structure
>pdb|2RD5|A Chain A, Structural Basis For The Regulation Of N-Acetylglutamate Kinase By Pii In Arabidopsis Thaliana Length = 298 Back     alignment and structure
>pdb|2JJ4|A Chain A, The Complex Of Pii And Acetylglutamate Kinase From Synechococcus Elongatus Pcc7942 Length = 321 Back     alignment and structure
>pdb|3ZZF|A Chain A, Crystal Structure Of The Amino Acid Kinase Domain From Saccharomyces Cerevisiae Acetylglutamate Kinase Complexed With Its Substrate N-Acetylglutamate Length = 307 Back     alignment and structure
>pdb|3ZZI|A Chain A, Crystal Structure Of A Tetrameric Acetylglutamate Kinase From Saccharomyces Cerevisiae Length = 464 Back     alignment and structure
>pdb|3S6K|A Chain A, Crystal Structure Of Xcnags Length = 467 Back     alignment and structure
>pdb|2AP9|A Chain A, Crystal Structure Of Acetylglutamate Kinase From Mycobacterium Tuberculosis Cdc1551 Length = 299 Back     alignment and structure
>pdb|3L86|A Chain A, The Crystal Structure Of Smu.665 From Streptococcus Mutans Ua159 Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query634
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 9e-78
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 7e-76
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 7e-48
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, t 1e-29
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, t 6e-06
2rd5_A298 Acetylglutamate kinase-like protein; protein-prote 4e-29
2rd5_A298 Acetylglutamate kinase-like protein; protein-prote 2e-05
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structura 5e-29
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structura 1e-05
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 1e-28
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 1e-05
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP 5e-27
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP 3e-05
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 2e-25
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 4e-24
4ab7_A464 Protein Arg5,6, mitochondrial; transferase, argini 8e-23
3l86_A279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 2e-22
3zzh_A307 Acetylglutamate kinase; transferase, arginine bios 3e-22
2egx_A269 Putative acetylglutamate kinase; struc genomics, N 6e-21
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino ac 2e-19
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 8e-17
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 2e-10
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 2e-09
3mgd_A157 Predicted acetyltransferase; structural genomics, 5e-09
1z4r_A168 General control of amino acid synthesis protein 5- 1e-08
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 2e-08
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 2e-08
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 8e-08
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 8e-08
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 9e-08
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 3e-07
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 3e-07
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 3e-07
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 5e-07
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 7e-07
2i6c_A160 Putative acetyltransferase; GNAT family, structura 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 1e-06
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 1e-06
2aj6_A159 Hypothetical protein MW0638; structural genomics, 2e-06
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 2e-06
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 2e-06
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 3e-06
3kkw_A182 Putative uncharacterized protein; acetyltransferas 3e-06
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 3e-06
2gan_A190 182AA long hypothetical protein; alpha-beta protei 3e-06
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 3e-06
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine 4e-06
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 4e-06
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 5e-06
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 5e-06
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 6e-06
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 8e-06
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 9e-06
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 1e-05
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 1e-05
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 1e-05
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 1e-05
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 1e-05
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 2e-05
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 3e-05
1vkc_A158 Putative acetyl transferase; structural genomics, 3e-05
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 3e-05
1wwz_A159 Hypothetical protein PH1933; structural genomics, 3e-05
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 3e-05
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 4e-05
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 4e-05
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 4e-05
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 6e-05
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 6e-05
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 7e-05
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 8e-05
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 8e-05
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 9e-05
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 9e-05
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 1e-04
3frm_A254 Uncharacterized conserved protein; APC61048, staph 2e-04
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 2e-04
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 2e-04
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 2e-04
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 2e-04
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 3e-04
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 3e-04
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 3e-04
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 3e-04
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 3e-04
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 3e-04
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 4e-04
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 4e-04
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 6e-04
1y7r_A133 Hypothetical protein SA2161; structural genomics, 6e-04
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 7e-04
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 7e-04
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 9e-04
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
 Score =  253 bits (649), Expect = 9e-78
 Identities = 82/251 (32%), Positives = 121/251 (48%), Gaps = 11/251 (4%)

Query: 69  GNVEETYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHH 128
           G V    +    + FV  FREA PY+   RG T V  I G ++    L+ +  DI  L  
Sbjct: 13  GLVPRGSHMNAPDSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAADIGLLSQ 72

Query: 129 LGIRFVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGGIRMMIEAKLSP 188
           LGIR VL+ G +  +D+L + +G    Y    R+TD  SL  A + AG +R   EA L  
Sbjct: 73  LGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRSRFEAALC- 131

Query: 189 GPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVDVTRMRERL 248
                        +      V + SGNFL A+  GV+DG D    G ++K D   +R +L
Sbjct: 132 -------GSVSGFA--RAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQL 182

Query: 249 DGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGP-ILDESGHLIRFL 307
           D G +V +  LG+S  G+  N +  + A + A++++A+KL+ +     I    G L   L
Sbjct: 183 DAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETL 242

Query: 308 TLQEADSLIRQ 318
           + QEA SL   
Sbjct: 243 SAQEAQSLAEH 253
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Length = 299 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Length = 299 Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Length = 467 Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Length = 460 Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Length = 464 Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Length = 279 Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Length = 307 Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Length = 258 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Length = 310 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Length = 174 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 175 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query634
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 100.0
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 100.0
4ab7_A464 Protein Arg5,6, mitochondrial; transferase, argini 100.0
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 100.0
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structura 100.0
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP 100.0
2rd5_A298 Acetylglutamate kinase-like protein; protein-prote 100.0
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, t 100.0
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 100.0
3zzh_A307 Acetylglutamate kinase; transferase, arginine bios 100.0
3l86_A279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 100.0
2egx_A269 Putative acetylglutamate kinase; struc genomics, N 100.0
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino ac 100.0
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthe 100.0
2e9y_A316 Carbamate kinase; transferase, structural genomics 100.0
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine 100.0
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinas 100.0
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetas 100.0
4axs_A332 Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm 100.0
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, k 100.0
3kzf_A317 Carbamate kinase; arginine dihydrolase pathway, gi 100.0
3ll5_A249 Gamma-glutamyl kinase related protein; alternate m 100.0
2j5v_A367 Glutamate 5-kinase; proline biosynthesis, gamma gl 99.97
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, prot 99.97
2ogx_A276 Molybdenum storage protein subunit alpha; open alp 99.97
2j4j_A226 Uridylate kinase; transferase, nucleoside monophos 99.96
4a7w_A240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 99.96
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genom 99.96
2ogx_B270 Molybdenum storage protein subunit beta; open alph 99.96
2ij9_A219 Uridylate kinase; structural genomics, protein str 99.96
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, p 99.96
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine bi 99.95
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.95
3ek6_A243 Uridylate kinase; UMPK unique GTP B site, alloster 99.95
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, 99.95
3nwy_A281 Uridylate kinase; allosterically activated form, A 99.94
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 99.94
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, 99.93
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.88
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 99.87
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 99.8
2j0w_A449 Lysine-sensitive aspartokinase 3; feedback inhibit 99.7
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 99.69
1tiq_A180 Protease synthase and sporulation negative regulat 99.63
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.63
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.62
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.62
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.61
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.61
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.6
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.59
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.59
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.59
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.59
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.58
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.58
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.58
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.57
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.57
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.57
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.57
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.57
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.57
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.56
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.56
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.56
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.56
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.55
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.55
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.55
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.55
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.55
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.54
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.54
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.54
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.54
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.53
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.53
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.53
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.53
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.53
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.52
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.52
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.52
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.52
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.52
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.52
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.51
1vkc_A158 Putative acetyl transferase; structural genomics, 99.51
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.51
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.51
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.51
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.51
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.51
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.5
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.5
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.5
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.5
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.49
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.49
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.49
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.49
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.49
3owc_A188 Probable acetyltransferase; structural genomics, P 99.48
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.48
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.47
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.47
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.47
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.47
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.47
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.47
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.47
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.46
1z4r_A168 General control of amino acid synthesis protein 5- 99.45
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.45
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.45
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.45
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.45
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.45
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.45
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.45
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.44
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.44
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.43
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.43
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.42
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.42
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.41
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.41
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.41
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.41
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.41
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.41
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 99.39
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.39
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.39
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.39
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.38
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.38
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.38
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.38
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.38
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.37
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.37
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.37
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.37
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.36
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.36
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.36
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.36
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.36
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 99.35
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.35
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.34
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.34
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.33
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.32
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.32
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 99.31
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.3
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.28
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.28
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.27
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.27
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 99.26
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.25
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.25
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.23
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 99.22
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.21
2qml_A198 BH2621 protein; structural genomics, joint center 99.21
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.2
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.19
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.19
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.19
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 99.19
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 99.19
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.18
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 99.18
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.18
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 99.17
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 99.17
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 99.15
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.15
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.15
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.15
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.06
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.03
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.01
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 98.96
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 98.96
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.96
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.86
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 98.86
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 98.77
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.57
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.32
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.32
1yle_A 342 Arginine N-succinyltransferase, alpha chain; struc 98.18
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.11
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 97.96
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 97.91
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 97.37
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 93.33
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 91.35
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 89.6
4b14_A 385 Glycylpeptide N-tetradecanoyltransferase; malaria, 88.54
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 85.91
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 85.39
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 85.34
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 84.05
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 84.0
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: 83.7
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 82.7
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 82.54
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-71  Score=611.19  Aligned_cols=429  Identities=36%  Similarity=0.594  Sum_probs=391.6

Q ss_pred             HHHHHHHHHhhhHHHhhcCCeEEEEECCccCCCCChHHHHHHHHHHHhCCCeEEEEeCchHHHHHHHHHcCCcccccCCc
Q 006709           81 EQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYLDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLGRY  160 (634)
Q Consensus        81 ~~~v~~~r~a~pYi~~~r~k~iVIKLGGsvL~~~~l~~la~dIa~L~~~G~kvVLVHGGG~~I~~~l~~lg~~~~~~~G~  160 (634)
                      .+|+++||+|+|||++||++++|||+||++|+++++..++++|+.|++.|++||||||||++++.+++++++++++.+|.
T Consensus        25 ~~~~~~~~~~~~yi~~~~~~~iViK~GG~~l~~~~~~~~~~~i~~l~~~g~~vvlVhggg~~~~~~~~~~~~~~~~~~g~  104 (456)
T 3d2m_A           25 DSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAADIGLLSQLGIRLVLIHGAYHFLDRLAAAQGRTPHYCRGL  104 (456)
T ss_dssp             CCHHHHHHHHHHHHHHHTTCEEEEEECGGGGTSTHHHHHHHHHHHHHHTTCEEEEEECCHHHHHTTTTTTTCCCCCGGGC
T ss_pred             hHHHHHHHHhHHHHHHhcCCEEEEEEChHHhcCchHHHHHHHHHHHHHCCCeEEEEeCCcHHHHHHHHHCCCCCEeeCCe
Confidence            57999999999999999999999999999999877999999999999999999999999999999999999999999999


Q ss_pred             cCCCHHHHHHHHHHHhHHHHHHHHhcCCCCchhhHHhcCCCCcceeEEeeccCCceeeeeecccccCccccccceEEEec
Q 006709          161 RITDSESLAAAMEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVVDGVDYGATGEVKKVD  240 (634)
Q Consensus       161 RvT~~~~l~~~~~a~G~in~~Lv~~L~~~~~~~~L~~~Gi~~~~~av~l~~~dg~~l~ak~~g~~~g~d~g~~G~v~~vd  240 (634)
                      |+|++++|+.+.+++|++|..++++         |+ +|++....++++++.|++|+++++.++.+++|++++|+|+.+|
T Consensus       105 r~t~~~~l~~~~~~~G~~~~~l~~~---------l~-~g~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~g~~g~v~~v~  174 (456)
T 3d2m_A          105 RVTDETSLGQAQQFAGTVRSRFEAA---------LC-GSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTD  174 (456)
T ss_dssp             CCBCHHHHHHHHHHHHHHHHHHHHH---------HH-TC--------CCCEECCSCEEEEECCEETTEECBTBEEEEEEC
T ss_pred             ecCCHHHHHHHHHHHhHHHHHHHHH---------Hh-cccccCCCccceeeccCcEEEEEEcccccCcccCceeeEEEEC
Confidence            9999999999855569999988886         45 7776322348999999999999998887888999999999999


Q ss_pred             HHHHHHHHcCCcEEEEcCCccCCCCceeeechHHHHHHHHHHcCCCEEEEeecccccC-CCCccccccCHHHHHHHHHhh
Q 006709          241 VTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILD-ESGHLIRFLTLQEADSLIRQR  319 (634)
Q Consensus       241 ~~~I~~LLd~G~IPVv~~v~~~~~Gei~nid~D~lAa~LA~aL~AdkLI~LTDVdgld-~~gklI~~ls~~e~~~li~~~  319 (634)
                      .+.|+.||++|.|||++|++.+.+|+++|+|+|++|+++|.+|+||+|||+|||||+. .++++|++++.+|+++++.. 
T Consensus       175 ~~~i~~lL~~g~ipIi~~~~~~~~g~~~~~~~D~~Aa~lA~~l~Ad~li~lTdvdGv~~~~~~~i~~i~~~e~~~~~~~-  253 (456)
T 3d2m_A          175 TAALRFQLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETLSAQEAQSLAEH-  253 (456)
T ss_dssp             HHHHHHHHHTTCEEEECSEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSSCBCTTSCBCSEEEHHHHHHHHTT-
T ss_pred             HHHHHHHHHCCCeEEECCcccCCCCCEEEECHHHHHHHHHHHcCCCEEEEEECCccccCCCCCccccCCHHHHHHHHhc-
Confidence            9999999999999999999999999999999999999999999999999999999974 57999999999988877531 


Q ss_pred             chhhhhHHHHHHhhhhccccccCCCCCCcccccCCCCCccccchhccccCCcccCCCCCCcccccccccCcccccccccC
Q 006709          320 VKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNG  399 (634)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~G~~~~~~~~~~GG~~~~~~~~~  399 (634)
                                                                                |         +||         
T Consensus       254 ----------------------------------------------------------g---------~gg---------  257 (456)
T 3d2m_A          254 ----------------------------------------------------------A---------ASE---------  257 (456)
T ss_dssp             ----------------------------------------------------------C---------CHH---------
T ss_pred             ----------------------------------------------------------c---------CCC---------
Confidence                                                                      1         145         


Q ss_pred             CHHHHHHHHHHHHcCCceEEEccCCcchhHHHHHHhhcCCccccccccccccccCccchHHHHHHhHHHHHHcccCccCC
Q 006709          400 YLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRT  479 (634)
Q Consensus       400 m~~Kl~AA~~a~~~Gv~rv~I~~g~~~~~ll~el~~~~g~GT~I~~D~Ye~iR~a~~~D~~~i~~l~~~~~~~~~~~~~~  479 (634)
                      |.+||+||..|++.|+++++|+|++.++.|+.++|++++.||+|.++.|..||+++++|++.+.+++..+....+..+++
T Consensus       258 m~~Kl~aa~~a~~~gv~~v~I~~~~~~~~ll~~l~~~~~~GT~i~~~~~~~IR~a~~~D~~~i~~l~~~~~~~~~~~~~~  337 (456)
T 3d2m_A          258 TRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRS  337 (456)
T ss_dssp             HHHHHHHHHHHHHTTCSEEEEEETTSTTHHHHHHHCSSCSSEEEECCCCCEEEECCGGGHHHHHHHHHHHHHHTSSCCCC
T ss_pred             hHHHHHHHHHHHHhCCCEEEEecCcCCchHHHHHHhhcCCceeeecccceeeCCCCHHHHHHHHHHHHHHHhcCCCccCC
Confidence            99999999999999999999999999999889999999999999999999999999999999999998877777777888


Q ss_pred             HHHHHhhcCcEEEEEECCeEEEEEEEeeecCCCeEEEEEEEECCCCcCCCHHHHHHhhhcccccccccccccccCCCcch
Q 006709          480 DEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLGLCIWPLLSETRYDHISTNGFPFL  559 (634)
Q Consensus       480 ~~~~~~~l~~~~V~~~~g~iiG~~~l~~~~~~~~~ei~~l~V~p~~rgqGiG~~Ll~~~i~~~~~~~~~~~~~~~~~~~~  559 (634)
                      .+.+.+.+..+++++.+|++|||+.+.+......++|..++|+|+|||||+|++|+                        
T Consensus       338 ~~~~~~~l~~~~va~~~g~iVG~~~~~~~~~~~~~~I~~l~V~p~~rg~GiG~~Ll------------------------  393 (456)
T 3d2m_A          338 REYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLL------------------------  393 (456)
T ss_dssp             HHHHHHHGGGEEEEEETTEEEEEEEEEECSSTTEEEEEEEEECGGGTTSSHHHHHH------------------------
T ss_pred             HHHHHHHHhhEEEEEECCEEEEEEEEEecCCCCEEEEEEEEECHHHcCCCHHHHHH------------------------
Confidence            99999888899999999999999999976566789999999999999999999999                        


Q ss_pred             HHHHHHHHHHcCCcEEEEecHHhHHHHHhCCCeecccccchhHhhhhccCC-CCceEEEeecC
Q 006709          560 RDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLS-RNSKYYMKKLL  621 (634)
Q Consensus       560 ~~~i~~~a~~~g~~~l~l~t~~a~~~Y~k~GF~~~~~~~~~~~~~~~~~~~-~~s~~~~k~l~  621 (634)
                       +++++++++.|++.+++.++++.+||+++||+..+...+|..++..|++. +++++|+|.|+
T Consensus       394 -~~~~~~a~~~g~~~i~l~N~~a~~fY~k~GF~~~~~~~~p~~~~~~y~~~~r~~~v~~k~L~  455 (456)
T 3d2m_A          394 -AHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRKDYRSNGRNSHILVRRLH  455 (456)
T ss_dssp             -HHHHHHHHHTTCCEEEEEESSCHHHHHTTTCEEECGGGSCHHHHHHHHHHCCCCEEEEEECC
T ss_pred             -HHHHHHHHHcCCCEEEEEcHHHHHHHHHCCCEEeCcccCCHHHHhhcccccCCeEEEEEEcC
Confidence             99999999999999999888899999999999999999999999999999 99999999985
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 634
d2bufa1300 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Ps 6e-35
d2btya1282 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Th 1e-34
d2btya1282 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Th 1e-10
d2ap9a1291 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {My 1e-26
d2ap9a1291 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {My 2e-10
d1e19a_313 c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcu 8e-15
d1b7ba_307 c.73.1.1 (A:) Carbamate kinase {Enterococcus faeci 5e-10
d1gs5a_258 c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escheri 5e-08
d1gs5a_258 c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escheri 2e-07
d1r57a_102 d.108.1.1 (A:) Hypothetical protein SA2309 {Staphy 7e-08
d1i12a_157 d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans 4e-07
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 1e-06
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 1e-06
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 6e-06
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 7e-06
d2hv2a2285 d.108.1.10 (A:2-286) Hypothetical protein EF1021 { 5e-05
d1yx0a1151 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bac 6e-05
d1z4ra1162 d.108.1.1 (A:497-658) Catalytic domain of GCN5 his 1e-04
d2i6ca1160 d.108.1.1 (A:1001-1160) Putative acetyltransferase 1e-04
d2i00a2291 d.108.1.10 (A:10-300) Putative acetyltransferase E 2e-04
d1y9wa1140 d.108.1.1 (A:1-140) Probable acetyltransferase BC2 6e-04
d1y9ka1152 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu 6e-04
d2aj6a1118 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S 9e-04
d1m4ia_181 d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera 0.001
d1sqha_297 d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr 0.001
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 0.004
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]

 Score =  132 bits (332), Expect = 6e-35
 Identities = 64/257 (24%), Positives = 116/257 (45%), Gaps = 25/257 (9%)

Query: 74  TYNPVEDEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPYL-DPILKDIAFLHHLGIR 132
           T +  +  Q  K   EA PY+    G T V+   G  + S  L     +D+  +  +GI 
Sbjct: 1   TLSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGIN 60

Query: 133 FVLVPGTHVQIDKLLSERGHEAKYLGRYRITDSESLAAAMEAAGG-IRMMIEAKLSPGPP 191
            V+V G   QI  LL     E+ ++   R+TD+ ++       GG +   I   ++    
Sbjct: 61  PVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLIN---- 116

Query: 192 ICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVV---------DGVDYGATGEVKKVDVT 242
                RHG S+    +G++      + AK+  V          + +D G  GEV  V+V 
Sbjct: 117 -----RHGGSA----IGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVG 167

Query: 243 RMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGP-ILDESG 301
            +   + G  + +++ +G  S+GE  N N   VA   A A++A+KL+ + +   ++D+ G
Sbjct: 168 LLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQG 227

Query: 302 HLIRFLTLQEADSLIRQ 318
            ++  L+ ++ + LI  
Sbjct: 228 QVLTGLSTEQVNELIAD 244
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 313 Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307 Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Length = 102 Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Length = 151 Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Length = 160 Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291 Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query634
d2bufa1300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginos 100.0
d2btya1282 N-acetyl-l-glutamate kinase {Thermotoga maritima [ 100.0
d2ap9a1291 N-acetyl-l-glutamate kinase {Mycobacterium tubercu 100.0
d1e19a_313 Carbamate kinase {Archaeon Pyrococcus furiosus [Ta 100.0
d1b7ba_307 Carbamate kinase {Enterococcus faecium [TaxId: 135 100.0
d1gs5a_258 N-acetyl-l-glutamate kinase {Escherichia coli [Tax 100.0
d2akoa1250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 99.93
d2brxa1225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 99.92
d2ij9a1219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 99.89
d1ybda1236 Uridylate kinase PyrH {Neisseria meningitidis [Tax 99.85
d2a1fa1236 Uridylate kinase PyrH {Haemophilus influenzae [Tax 99.84
d1z9da1238 Uridylate kinase PyrH {Streptococcus pyogenes [Tax 99.78
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.71
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.66
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.66
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.66
d1tiqa_173 Protease synthase and sporulation negative regulat 99.66
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.65
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.65
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.64
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.63
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.62
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.62
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.6
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.6
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.6
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.6
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.6
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.6
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.59
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.58
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.57
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.54
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.54
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.54
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.53
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.53
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.52
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.5
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.49
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.49
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.48
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.48
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.47
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.46
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.45
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.44
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.44
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.43
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.4
d2hmfa1302 Aspartokinase {Methanococcus jannaschii [TaxId: 21 99.38
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.37
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.37
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.36
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.34
d2cdqa1304 Aspartokinase {Thale cress (Arabidopsis thaliana) 99.28
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 99.26
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.22
d2j0wa1292 Aspartokinase {Escherichia coli [TaxId: 562]} 99.16
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 99.16
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 99.15
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.1
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.07
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.03
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 99.01
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 98.94
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.94
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 98.91
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 98.88
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 98.84
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 98.78
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.52
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 97.82
d1ylea1338 Arginine N-succinyltransferase, alpha chain, AstA 97.14
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 96.86
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 96.62
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 95.1
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 90.56
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 90.51
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 90.09
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 89.23
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 89.22
d2d4pa1130 Hypothetical protein TTHA1254 {Thermus thermophilu 86.42
d1iica2237 N-myristoyl transferase, NMT {Baker's yeast (Sacch 86.28
d1iyka2227 N-myristoyl transferase, NMT {Yeast (Candida albic 84.7
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=1.1e-55  Score=459.86  Aligned_cols=281  Identities=28%  Similarity=0.464  Sum_probs=261.8

Q ss_pred             hHHHHHHHHHhhhHHHhhcCCeEEEEECCccCCCCC-hHHHHHHHHHHHhCCCeEEEEeCchHHHHHHHHHcCCcccccC
Q 006709           80 DEQFVKWFREAWPYLWAHRGGTFVVIISGEIVSSPY-LDPILKDIAFLHHLGIRFVLVPGTHVQIDKLLSERGHEAKYLG  158 (634)
Q Consensus        80 ~~~~v~~~r~a~pYi~~~r~k~iVIKLGGsvL~~~~-l~~la~dIa~L~~~G~kvVLVHGGG~~I~~~l~~lg~~~~~~~  158 (634)
                      ..+|+++||+|+|||++||+|+|||||||+++++++ +.++++||+.|+..|.++|||||||||++..++++++++++++
T Consensus         7 ~~~~~~~l~~a~PYi~~~r~ktiVIKlGG~~l~~~~~~~~~~~dIa~L~~~G~~vViVhGgg~~i~~~l~~~gi~~~~~~   86 (300)
T d2bufa1           7 AAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFID   86 (300)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCEEEEEECCTTTTSSHHHHHHHHHHHHHHHTTCEEEEEECCCHHHHHHHHHTTCCCCBSS
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEEEChHHhCChhHHHHHHHHHHHHHHcCCcEEEecChHHHHHHHHHhcccCceecC
Confidence            578999999999999999999999999999999877 6899999999999999999999999999999999999999999


Q ss_pred             CccCCCHHHHHHH-HHHHhHHHHHHHHhcCCCCchhhHHhcCCCCcceeEEeeccCCceeeeeecccc---------cCc
Q 006709          159 RYRITDSESLAAA-MEAAGGIRMMIEAKLSPGPPICNIRRHGDSSRWHEVGVSVASGNFLAAKRKGVV---------DGV  228 (634)
Q Consensus       159 G~RvT~~~~l~~~-~~a~G~in~~Lv~~L~~~~~~~~L~~~Gi~~~~~av~l~~~dg~~l~ak~~g~~---------~g~  228 (634)
                      |+|+|+++.|+.+ +++.|++|..++++         |.++|++    ++++++.|+.++.+++..+.         +++
T Consensus        87 g~RvT~~~~l~~~~~~~~g~vn~~lv~~---------l~~~g~~----a~~l~~~d~~~i~~~~~~~~~~~~~~~~~~~i  153 (300)
T d2bufa1          87 GMRVTDAATMDVVEMVLGGQVNKDIVNL---------INRHGGS----AIGLTGKDAELIRAKKLTVTRQTPEMTKPEII  153 (300)
T ss_dssp             SSBCBCHHHHHHHHHHHHHTHHHHHHHH---------HHHTTCC----EEEEEETGGGCEEEEECCCCCC--------CC
T ss_pred             CcccccchhHHHHHHHHHhHHHHHHHHH---------HHhcCCc----ccccCCCccceEEeecccccccCccccccccc
Confidence            9999999999998 67789999999997         5788987    89999999999998876543         467


Q ss_pred             cccccceEEEecHHHHHHHHcCCcEEEEcCCccCCCCceeeechHHHHHHHHHHcCCCEEEEeeccccc-CCCCcccccc
Q 006709          229 DYGATGEVKKVDVTRMRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPIL-DESGHLIRFL  307 (634)
Q Consensus       229 d~g~~G~v~~vd~~~I~~LLd~G~IPVv~~v~~~~~Gei~nid~D~lAa~LA~aL~AdkLI~LTDVdgl-d~~gklI~~l  307 (634)
                      |++|+|+|+.+|.+.|+.||+.|.|||++|++++.+|+++|+|+|.+|+++|.+|+||+||||||+||+ +.++++++++
T Consensus       154 d~g~~G~v~~v~~~~i~~ll~~g~Ipvis~~~~~~~G~~~nin~D~~Aa~lA~~L~AdkLI~Ltdv~Gv~~~~g~~~~~l  233 (300)
T d2bufa1         154 DIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGL  233 (300)
T ss_dssp             CCBSBEEEEEECHHHHHHHHHTTCEEEEEEEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCTTSCBCCEE
T ss_pred             ccCcccceeecchhHHHHHhcCCCeEEecccccCcccchhcccHHHHHHHHHHHcCCCeEEEEcCCCccccCCCcchhhc
Confidence            999999999999999999999999999999999999999999999999999999999999999999987 6789999999


Q ss_pred             CHHHHHHHHHhhchhhhhHHHHHHhhhhccccccCCCCCCcccccCCCCCccccchhccccCCcccCCCCCCcccccccc
Q 006709          308 TLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFA  387 (634)
Q Consensus       308 s~~e~~~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~G~~~~~~~~~  387 (634)
                      +.++++++++.+.                                                                  .
T Consensus       234 ~~~~~~~li~~~~------------------------------------------------------------------i  247 (300)
T d2bufa1         234 STEQVNELIADGT------------------------------------------------------------------I  247 (300)
T ss_dssp             CHHHHHHHHHTTC------------------------------------------------------------------S
T ss_pred             cHHHHHHHHHcCC------------------------------------------------------------------c
Confidence            9999999886422                                                                  2


Q ss_pred             cCcccccccccCCHHHHHHHHHHHHcCCceEEEccCCcchhHHHHHHhhcCCccccccccc
Q 006709          388 IGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLY  448 (634)
Q Consensus       388 ~GG~~~~~~~~~m~~Kl~AA~~a~~~Gv~rv~I~~g~~~~~ll~el~~~~g~GT~I~~D~Y  448 (634)
                      +||         |.+||++|..||+.||+||||+||+.+++||.|||+++|+||+|+++.|
T Consensus       248 ~gG---------M~~Kl~aa~~a~~~Gv~rv~Ii~g~~~~~ll~eLft~~g~GT~I~~~~~  299 (300)
T d2bufa1         248 YGG---------MLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKR  299 (300)
T ss_dssp             CTT---------HHHHHHHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCCSEEEECCCC
T ss_pred             Cch---------HHHHHHHHHHHHHcCCCEEEEecCCCCCHHHHHHcCCCCceeEEecCCC
Confidence            345         9999999999999999999999999999999999999999999999887
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure