Citrus Sinensis ID: 006711


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630----
MLHELLLALLGYTGDLIIDEREHQNSAATPLSGDAPISEECSFKLAPDISFIEPSERDLLEKIITLGFYYREIDRFASKARNLSWIRSANASPLERAAELSKSKTERPSVYRRAIANGIVEILSVYRSAVLLIEQKLLSETMPILATVTQGLNKFFVLFPPLYELVLEIERDDIRGGQLLNLLHKRCHCGMPELQACIQRLLWHGHQVMYNQLASWMVYGILQDQHGEFFIRRQEDRDTEHCSSHSDVSEKLARLSTDYTSVTDWHLGFHIFLDMLPEYIHMRIAESILFAGKAVRVLRNPSSAFRFQDQLITRSSQKIQGVTGRFSIQKEPLLDMKLIGEELLPQSDADKIEAMLQGLKEPSEFHKRSFECAVDSIRAIAASHLWQLVVVRANLNGHLKALKDYFLLEKGDFFQCFLEESRQLMRLPPRQSTAEADLMVPFQLAAIKTISEEDKYFSRVSLRMPSFGITVKSPHVDLLKAKAYADGTSGAALSSGNSDISLDGWDGIALEYSVDWPLQLFFTQEVLSKYCKVFQYLLRLKRTQMELEKSWASVMHQDHTYFAKHRNDRINYSKSQQRRQTCRPMWRVREHMAFLIRNLQFYIQVDVIETQWNILQAHIQESHDFTELVGFHQE
cHHHHHHHHcccccccEEEccccccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccHHHHHHHccccccccccccccEEEEcccccccccHHHHHHHHHHcHHHHHccccccccccHHHHHHHHHHccccccccccccccccHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcc
MLHELLLALLGYTGDLIIDEREHQNSAATPLSGDAPISEECSFKLAPDISFIEPSERDLLEKIITLGFYYREIDRFASKARNLSWIRSA****************ERPSVYRRAIANGIVEILSVYRSAVLLIEQKLLSETMPILATVTQGLNKFFVLFPPLYELVLEIERDDIRGGQLLNLLHKRCHCGMPELQACIQRLLWHGHQVMYNQLASWMVYGILQDQHGEFFIRRQED***************LARLSTDYTSVTDWHLGFHIFLDMLPEYIHMRIAESILFAGKAVRVLRNPSSAFRFQDQLITRSSQKIQGVTGRFSIQKEPLLDMKLIGEELLPQSDADKIEAMLQGLKEPSEFHKRSFECAVDSIRAIAASHLWQLVVVRANLNGHLKALKDYFLLEKGDFFQCFLEESRQLMR******TAEADLMVPFQLAAIKTISEEDKYFSRVSLRMPSFGITVKSPHVDLLKAKAYADGTSGAAL***NSDISLDGWDGIALEYSVDWPLQLFFTQEVLSKYCKVFQYLLRLKRTQMELEKSWASVMHQDHTYFAKHRNDRINY*****RRQTCRPMWRVREHMAFLIRNLQFYIQVDVIETQWNILQAHIQESHDFTELVGFH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLHELLLALLGYTGDLIIDEREHQNSAATPLSGDAPISEECSFKLAPDISFIEPSERDLLEKIITLGFYYREIDRFASKARNLSWIRSANASPLERAAELSKSKTERPSVYRRAIANGIVEILSVYRSAVLLIEQKLLSETMPILATVTQGLNKFFVLFPPLYELVLEIERDDIRGGQLLNLLHKRCHCGMPELQACIQRLLWHGHQVMYNQLASWMVYGILQDQHGEFFIRRQEDRDTEHCSSHSDVSEKLARLSTDYTSVTDWHLGFHIFLDMLPEYIHMRIAESILFAGKAVRVLRNPSSAFRFQDQLITRSSQKIQGVTGRFSIQKEPLLDMKLIGEELLPQSDADKIEAMLQGLKEPSEFHKRSFECAVDSIRAIAASHLWQLVVVRANLNGHLKALKDYFLLEKGDFFQCFLEESRQLMRLPPRQSTAEADLMVPFQLAAIKTISEEDKYFSRVSLRMPSFGITVKSPHVDLLKAKAYADGTSGAALSSGNSDISLDGWDGIALEYSVDWPLQLFFTQEVLSKYCKVFQYLLRLKRTQMELEKSWASVMHQDHTYFAKHRNDRINYSKSQQRRQTCRPMWRVREHMAFLIRNLQFYIQVDVIETQWNILQAHIQESHDFTELVGFHQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-tubulin complex component 4 homolog Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.confidentQ9M350
Gamma-tubulin complex component 4 homolog Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.probableQ9SC88

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RIP, chain A
Confidence level:very confident
Coverage over the Query: 1-21,40-87,107-234,265-312,342-468,502-634
View the alignment between query and template
View the model in PyMOL