Citrus Sinensis ID: 006746


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--
MQSPCLREVSQACLCTHGGCCPSPFFSLSPDPLHKVSKSRNTSADCRRDFAAVTASSIFPDTQFTNHESLPSLQQSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPSHLRPSLPSQNLDIPFFSVSYKTGNLKTQLLHGGQESGLESAMKKRIMDFLNISENDYGMVFTANRTSAFKLLAESYPFMSVKNLLTVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDEFSSCETEPEQTSKSKQEKVAATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVLEKTDREAKSKSDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQKTIEV
cccccHHcccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccEEEccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHcccEEEEEccccccccccccccccccccEEEEEEcccccccccccCEEEEEcccccccccccccccEEEccccccccccccccccccccccccccHHHHHHccccccccccHHHHHccccccccHHHHHHHHHcccccccccccccccccEEccccHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccEEEEEEEccccccccHHHHHHHHHHccEEEEEcccccHHHHHHHHHccHHHHHHHHHcccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccc
*********SQACLCTHGGCCPSPF***************************V****I***T************QSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPSHLRPSLPSQNLDIPFFSVSYKTGNLKTQLLH****SGLESAMKKRIMDFLNISENDYGMVFTANRTSAFKLLAESYPFMSVKNLLTVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDEF**CETEP*QTSKSKQEKVAATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVL**T*******SDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQ*TI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSPCLREVSQACLCTHGGCCPSPFFSLSPDPLHKVSKSRNTSADCRRDFAAVTASSIFPDTQFTNHESLPSLQQSLTEFTKAYPQYFDTYQIDQIRAKEYYQLSLSNHTCLDYFGIGLFSYNQLHKQESSPSHLRPSLPSQNLDIPFFSVSYKTGNLKTQLLHGGQESGLESAMKKRIMDFLNISENDYGMVFTANRTSAFKLLAESYPFMSVKNLLTVYDYESEAVEAMIRTSEKRGARVMSAEFSWPRLRINSEKLRKMVVSKGKKKKQRGLFVFPLHSRMTGARYPYLWMRIAQENDWHILIDACALGPKDMDSFGLSLVRPDFLICSFYQIFGENPSGFGCLFVKKSTVPILVDNTSSGMVSLLPAKKQLWLTDEFSSCETEPEQTSKSKQEKVAATNTFSGPMSIEMRQSGKLEQGEISEVRRAEADSIQQKNANTNGGGGSEIECRGLDQVDSLGLTMISRRGRCLINWLVNALMKLQHPNTEGNALVKIYGPKIRFDRGPALAFNVFDWKREKIEPVLVQKLADRENISLSYGSLHHIWFSDKYQKEKDNVLEKTDREAKSKSDNNRKDKANLGITVVTASLGYLANFEDVYRLWAFVAQFLDADFVEKARWRYTALDQKTIEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CAI, chain A
Confidence level:very confident
Coverage over the Query: 92-135,155-366,392-395,415-428,453-552,563,579-609
View the alignment between query and template
View the model in PyMOL
Template: 1QZ9, chain A
Confidence level:confident
Coverage over the Query: 76-144,156-394,414-428,453-540,581-621
View the alignment between query and template
View the model in PyMOL
Template: 3E9K, chain A
Confidence level:confident
Coverage over the Query: 93-389,406-428,453-541,582-612
View the alignment between query and template
View the model in PyMOL
Template: 2Z67, chain A
Confidence level:confident
Coverage over the Query: 73-365,400-402,422-428,453-567,580-609
View the alignment between query and template
View the model in PyMOL
Template: 2JIS, chain A
Confidence level:confident
Coverage over the Query: 108-132,156-376,399-428,453-534,545-611
View the alignment between query and template
View the model in PyMOL