Citrus Sinensis ID: 006790


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
cEEEEccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHcccEEEEEccccccHHHHHHHccccccccEEEccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccEECccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccCEEEEccccccccccccccEEEEEcccHHHHHHHHHcccEEEEEcccccccccHHHHccccccEEEECcCEccccccccEEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccHHHHHHccccEEEEcccHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccEEEEEcccccccccc
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTxxxxxxxxxxxxxxxxxxxxxDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA repair helicase UVH6 Putative ATP-dependent 5'-3' DNA helicase involved in nucleotide excision repair (NER) of UV-damaged DNA. May open DNA around the damage. Essential during plant growth. May negatively regulate a common response program mediated by UV damage and heat stress, that leads to tissue death and reduced chloroplast function.confidentQ8W4M7
DNA repair helicase rad15 ATP-dependent DNA helicase involved in excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Necessary for excision of pyrimidine dimers. Also unwinds DNA/RNA duplexes. Plays an essential role in the cell viability.probableP26659
TFIIH basal transcription factor complex helicase XPD subunit ATP-dependent 5'-3' DNA helicase, component of the core-TFIIH basal transcription factor. Involved in nucleotide excision repair (NER) of DNA by opening DNA around the damage, and in RNA transcription by RNA polymerase II by anchoring the CDK-activating kinase (CAK) complex, composed of CDK7, cyclin H and MAT1, to the core-TFIIH complex. Involved in the regulation of vitamin-D receptor activity. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation. Might have a role in aging process and could play a causative role in the generation of skin cancers.probableP18074

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.12DNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A15, chain A
Confidence level:very confident
Coverage over the Query: 18-344,355-363,375-631
View the alignment between query and template
View the model in PyMOL
Template: 3CRV, chain A
Confidence level:very confident
Coverage over the Query: 13-135,154-269,283-344,359-370,392-551,563-631
View the alignment between query and template
View the model in PyMOL
Template: 2VSF, chain A
Confidence level:probable
Coverage over the Query: 40-290,305-364,385-393,412-625
View the alignment between query and template
View the model in PyMOL