Citrus Sinensis ID: 006790

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
cEEEEccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccHHHHHHHccccccccHHHHHHHHHcccEEEEEccccccHHHHHHHccccccccEEEccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEcccHHHHHHHHHcccEEEEEcccccccccHHHHHcccccEEEEEcEEccccccccEEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccHHHHHHccccEEEEcccHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccEEEEEcccccccccc
cEEEEccEEEEcccccccHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHcHHHcccccEHHHHHHHHHHHHHHHHHHcccccccccHHHcHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHccEEEEEHHHHccHHHHHHHHHHcccccEEEEEccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHcccHHHHHHcHHHHHHccccccEEEEEccccccccccccEEEEEEccHHHHHHHHHHHccEEEEEccccccHHHHHHHcccccEEEEccccEccccccEEEEEEccccccEEEEcEcccccHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccHHHHHHHcccEEEccccHHHHHHHHHHHHHHccccccEEEEEEEcccEEcccccccccccEEEEEEccccccccc
mifkledvtvyfpydniypeQYSYMLELKRALDAkghcllemptgtgKTIALLSLITSYvlskpenpvkliYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAaenpnietceFFENYEKAAsaavlppgvytlQDLRAfgkqqgwcpyFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLAlrgnlpiadawlsnpalpsdilkeavpgnirRAEHFLHVLRRLVQYLRGrletenvekegpvSFVASITAHAGIDQKTLRFCYERLHSLMLTleitdtdeflHIQTICDFAtlvgtytrgfsiiiepfdermphipdpvlqlschdaslavkpvfdRFQSvvitsgtlspidlyprllnfhpvvsrsfkmsltrdcicpmvltrgsdqlpvstkfdmrsdpgvarNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYrkacdcgrgavffsvargkvaegidfdrhyGRLVIMFGVpfqytlsk
mifkledvtvyfpydNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSyvlskpenpVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVlaaenrdsvdaACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEgatrnlsrinqeierfkatdagrlRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLetenvekegpvSFVASitahagidqKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITsgtlspidlyPRLLNFHPVVSRSFKMSLTRDCICPMVltrgsdqlpvstkfdmrsdpGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
**FKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYT***
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAK***************ALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVL******SVDAACRKR*****************CEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASIT*************YERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIE*******TLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYT***
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTxxxxxxxxxxxxxxxxxxxxxDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query631 2.2.26 [Sep-21-2011]
Q8W4M7 758 DNA repair helicase UVH6 yes no 1.0 0.832 0.877 0.0
A6QLJ0 760 TFIIH basal transcription yes no 1.0 0.830 0.543 0.0
Q60452 760 TFIIH basal transcription yes no 1.0 0.830 0.541 0.0
P18074 760 TFIIH basal transcription yes no 1.0 0.830 0.543 0.0
O08811 760 TFIIH basal transcription yes no 1.0 0.830 0.543 0.0
Q55G81 776 TFIIH basal transcription yes no 0.987 0.802 0.537 0.0
P26659 772 DNA repair helicase rad15 yes no 0.998 0.816 0.516 0.0
P06839 778 DNA repair helicase RAD3 yes no 0.998 0.809 0.473 0.0
P0C928 1177 Regulator of telomere elo no no 0.908 0.486 0.262 3e-49
Q7QEI1 991 Regulator of telomere elo no no 0.893 0.569 0.245 9e-45
>sp|Q8W4M7|ERCC2_ARATH DNA repair helicase UVH6 OS=Arabidopsis thaliana GN=UVH6 PE=1 SV=1 Back     alignment and function desciption
 Score = 1184 bits (3062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/631 (87%), Positives = 599/631 (94%)

Query: 1   MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYV 60
           MIFK+EDVTVYFPYDNIYPEQY YM+ELKRALDAKGHCLLEMPTGTGKTIALLSLITSY 
Sbjct: 1   MIFKIEDVTVYFPYDNIYPEQYEYMVELKRALDAKGHCLLEMPTGTGKTIALLSLITSYR 60

Query: 61  LSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSR 120
           LS+P++P+KL+YCTRTVHEMEKTL ELKLLH+YQ RHLG  AKILA+GLSSRKNLCVN++
Sbjct: 61  LSRPDSPIKLVYCTRTVHEMEKTLGELKLLHDYQVRHLGTQAKILALGLSSRKNLCVNTK 120

Query: 121 VLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDL 180
           VLAAENRDSVDAACRKRTASWVRAL+ ENPN+E C+FFENYEKAA  A+LPPGVYTL+DL
Sbjct: 121 VLAAENRDSVDAACRKRTASWVRALSTENPNVELCDFFENYEKAAENALLPPGVYTLEDL 180

Query: 181 RAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID 240
           RAFGK +GWCPYFLARHM+QFANV+VYSYQYLLDPKVAG ISKE+QKESVVVFDEAHNID
Sbjct: 181 RAFGKNRGWCPYFLARHMIQFANVIVYSYQYLLDPKVAGFISKELQKESVVVFDEAHNID 240

Query: 241 NVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPI 300
           NVCIEALSVSVRR TLEGA RNL++I QEI+RFKATDAGRLRAEYNRLVEGLALRG+L  
Sbjct: 241 NVCIEALSVSVRRVTLEGANRNLNKIRQEIDRFKATDAGRLRAEYNRLVEGLALRGDLSG 300

Query: 301 ADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVAS 360
            D WL+NPALP DILKEAVPGNIRRAEHF+HVLRRL+QYL  RL+TENVEKE PVSFV+S
Sbjct: 301 GDQWLANPALPHDILKEAVPGNIRRAEHFVHVLRRLLQYLGVRLDTENVEKESPVSFVSS 360

Query: 361 ITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEP 420
           + + AGI+QKTL+FCY+RL SLMLTLEITDTDEFL IQT+CDFATLVGTY RGFSIIIEP
Sbjct: 361 LNSQAGIEQKTLKFCYDRLQSLMLTLEITDTDEFLPIQTVCDFATLVGTYARGFSIIIEP 420

Query: 421 FDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS 480
           +DERMPHIPDP+LQLSCHDASLA+KPVFDRFQSVVITSGTLSPIDLYPRLLNF PVVSRS
Sbjct: 421 YDERMPHIPDPILQLSCHDASLAIKPVFDRFQSVVITSGTLSPIDLYPRLLNFTPVVSRS 480

Query: 481 FKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFV 540
           FKMS+TRDCICPMVLTRGSDQLPVSTKFDMRSDPGV RNYGKLLVEMVSIVPDG+VCFFV
Sbjct: 481 FKMSMTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVVRNYGKLLVEMVSIVPDGVVCFFV 540

Query: 541 SYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVA 600
           SYSYMD IIATWN++GILKEIMQ KLVFIETQDVVETTLALDNYR+ACDCGRGAVFFSVA
Sbjct: 541 SYSYMDGIIATWNETGILKEIMQQKLVFIETQDVVETTLALDNYRRACDCGRGAVFFSVA 600

Query: 601 RGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK 631
           RGKVAEGIDFDRHYGRLV+M+GVPFQYTLSK
Sbjct: 601 RGKVAEGIDFDRHYGRLVVMYGVPFQYTLSK 631
Putative ATP-dependent 5'-3' DNA helicase involved in nucleotide excision repair (NER) of UV-damaged DNA. May open DNA around the damage. Essential during plant growth. May negatively regulate a common response program mediated by UV damage and heat stress, that leads to tissue death and reduced chloroplast function.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|A6QLJ0|ERCC2_BOVIN TFIIH basal transcription factor complex helicase XPD subunit OS=Bos taurus GN=ERCC2 PE=2 SV=1 Back     alignment and function description
>sp|Q60452|ERCC2_CRIGR TFIIH basal transcription factor complex helicase XPD subunit OS=Cricetulus griseus GN=ERCC2 PE=1 SV=1 Back     alignment and function description
>sp|P18074|ERCC2_HUMAN TFIIH basal transcription factor complex helicase XPD subunit OS=Homo sapiens GN=ERCC2 PE=1 SV=1 Back     alignment and function description
>sp|O08811|ERCC2_MOUSE TFIIH basal transcription factor complex helicase XPD subunit OS=Mus musculus GN=Ercc2 PE=2 SV=2 Back     alignment and function description
>sp|Q55G81|ERCC2_DICDI TFIIH basal transcription factor complex helicase repD subunit OS=Dictyostelium discoideum GN=repD PE=2 SV=1 Back     alignment and function description
>sp|P26659|RAD15_SCHPO DNA repair helicase rad15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad15 PE=1 SV=2 Back     alignment and function description
>sp|P06839|RAD3_YEAST DNA repair helicase RAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD3 PE=1 SV=1 Back     alignment and function description
>sp|P0C928|RTEL1_DANRE Regulator of telomere elongation helicase 1 OS=Danio rerio GN=rtel1 PE=3 SV=1 Back     alignment and function description
>sp|Q7QEI1|RTEL1_ANOGA Regulator of telomere elongation helicase 1 homolog OS=Anopheles gambiae GN=AGAP000634 PE=3 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
255559474 758 DNA repair helicase rad3/xp-d, putative 1.0 0.832 0.920 0.0
224062561 758 predicted protein [Populus trichocarpa] 1.0 0.832 0.906 0.0
225437002 758 PREDICTED: DNA repair helicase UVH6 [Vit 1.0 0.832 0.901 0.0
356559661 758 PREDICTED: DNA repair helicase UVH6-like 1.0 0.832 0.889 0.0
356499550 758 PREDICTED: DNA repair helicase UVH6-like 1.0 0.832 0.887 0.0
15218736 758 DNA repair helicase UVH6 [Arabidopsis th 1.0 0.832 0.877 0.0
297843126 758 hypothetical protein ARALYDRAFT_470299 [ 1.0 0.832 0.877 0.0
6503086 758 nucleotide excision repair protein XP-D 1.0 0.832 0.876 0.0
3850576 735 Strong similarity to gb|U04968 nucleotid 1.0 0.858 0.860 0.0
449462346 919 PREDICTED: LOW QUALITY PROTEIN: DNA repa 0.998 0.685 0.861 0.0
>gi|255559474|ref|XP_002520757.1| DNA repair helicase rad3/xp-d, putative [Ricinus communis] gi|223540142|gb|EEF41719.1| DNA repair helicase rad3/xp-d, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1236 bits (3199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/631 (92%), Positives = 612/631 (96%)

Query: 1   MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYV 60
           M F++EDVTVYFPYDNIYPEQYSYM+ELKRALDAKGHCLLEMPTGTGKTIALLSLITSY 
Sbjct: 1   MKFQIEDVTVYFPYDNIYPEQYSYMIELKRALDAKGHCLLEMPTGTGKTIALLSLITSYS 60

Query: 61  LSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSR 120
           LSKP++PVKLIYCTRTVHEMEKTLAELKLLHNYQ +HLGPAA+ILAIGLSSRKNLCVN R
Sbjct: 61  LSKPQSPVKLIYCTRTVHEMEKTLAELKLLHNYQIKHLGPAARILAIGLSSRKNLCVNPR 120

Query: 121 VLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDL 180
           VLAAENRDSVDA CRK TASW+RA+AAENPNI TCEFFENYE+AASAAVLPPGVYTLQDL
Sbjct: 121 VLAAENRDSVDAGCRKLTASWMRAMAAENPNIPTCEFFENYERAASAAVLPPGVYTLQDL 180

Query: 181 RAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID 240
           R +GK++GWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID
Sbjct: 181 RTYGKEKGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID 240

Query: 241 NVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPI 300
           NVCIEALSVSVR+QTLEGA+RNLSRINQEIERFKATDAGRLRAEYNRLVEGLA RGNL +
Sbjct: 241 NVCIEALSVSVRKQTLEGASRNLSRINQEIERFKATDAGRLRAEYNRLVEGLAQRGNLAV 300

Query: 301 ADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVAS 360
            D WLSNPALP DILKEAVPGNIRRAEHFLHVLRRLVQYL+GRL+TENVEKE PVSFVAS
Sbjct: 301 TDTWLSNPALPDDILKEAVPGNIRRAEHFLHVLRRLVQYLKGRLDTENVEKESPVSFVAS 360

Query: 361 ITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEP 420
           + + AGIDQKTL+FCY+RLHSLMLTLEITDTDEFLH+QTICDFATLVGTY+RGFSIIIEP
Sbjct: 361 LNSQAGIDQKTLKFCYDRLHSLMLTLEITDTDEFLHVQTICDFATLVGTYSRGFSIIIEP 420

Query: 421 FDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS 480
           FDERMPHIPDPVLQLSCHDASLA+KPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS
Sbjct: 421 FDERMPHIPDPVLQLSCHDASLAIKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS 480

Query: 481 FKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFV 540
           F MSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVS+VPDGIVCFFV
Sbjct: 481 FTMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSVVPDGIVCFFV 540

Query: 541 SYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVA 600
           SYSYMD II +WN++GILKEIMQHKLVFIETQDVVETTLALDNYR+ACDCGRGAVFFSVA
Sbjct: 541 SYSYMDGIINSWNETGILKEIMQHKLVFIETQDVVETTLALDNYRRACDCGRGAVFFSVA 600

Query: 601 RGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK 631
           RGKVAEGIDFDRHYGRLVIMFG+PFQYTLSK
Sbjct: 601 RGKVAEGIDFDRHYGRLVIMFGIPFQYTLSK 631

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224062561|ref|XP_002300852.1| predicted protein [Populus trichocarpa] gi|222842578|gb|EEE80125.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437002|ref|XP_002277634.1| PREDICTED: DNA repair helicase UVH6 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559661|ref|XP_003548117.1| PREDICTED: DNA repair helicase UVH6-like [Glycine max] Back     alignment and taxonomy information
>gi|356499550|ref|XP_003518602.1| PREDICTED: DNA repair helicase UVH6-like [Glycine max] Back     alignment and taxonomy information
>gi|15218736|ref|NP_171818.1| DNA repair helicase UVH6 [Arabidopsis thaliana] gi|30678494|ref|NP_849584.1| DNA repair helicase UVH6 [Arabidopsis thaliana] gi|57013122|sp|Q8W4M7.1|ERCC2_ARATH RecName: Full=DNA repair helicase UVH6; AltName: Full=ERCC2 homolog; AltName: Full=RAD3 homolog; Short=AtUVH6; Short=AtXPD; AltName: Full=UV hypersensitive protein 6; AltName: Full=XPD homolog gi|17064790|gb|AAL32549.1| Strong similarity to nucleotide excision repair protein [Arabidopsis thaliana] gi|20258776|gb|AAM13910.1| putative DNA repair protein [Arabidopsis thaliana] gi|22651570|gb|AAM10793.1| DNA repair/transcription factor protein [Arabidopsis thaliana] gi|34098809|gb|AAQ56787.1| At1g03190 [Arabidopsis thaliana] gi|332189421|gb|AEE27542.1| DNA repair helicase UVH6 [Arabidopsis thaliana] gi|332189422|gb|AEE27543.1| DNA repair helicase UVH6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843126|ref|XP_002889444.1| hypothetical protein ARALYDRAFT_470299 [Arabidopsis lyrata subsp. lyrata] gi|297335286|gb|EFH65703.1| hypothetical protein ARALYDRAFT_470299 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6503086|gb|AAF14582.1|AF188623_1 nucleotide excision repair protein XP-D homolog [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3850576|gb|AAC72116.1| Strong similarity to gb|U04968 nucleotide excision repair protein (ERCC2) from Cricetulus grisseus [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449462346|ref|XP_004148902.1| PREDICTED: LOW QUALITY PROTEIN: DNA repair helicase UVH6-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
TAIR|locus:2014525 758 UVH6 "ULTRAVIOLET HYPERSENSITI 1.0 0.832 0.877 3e-307
ZFIN|ZDB-GENE-040426-997 760 ercc2 "excision repair cross-c 1.0 0.830 0.546 8.6e-191
UNIPROTKB|Q91941 760 ERCC2/XPD "ERCC2/XPD protein" 1.0 0.830 0.543 6e-190
UNIPROTKB|J9NWT1707 ERCC2 "Uncharacterized protein 1.0 0.892 0.543 7.7e-190
UNIPROTKB|A6QLJ0 760 ERCC2 "TFIIH basal transcripti 1.0 0.830 0.543 1.3e-189
UNIPROTKB|F1PMH9 771 ERCC2 "Uncharacterized protein 0.993 0.813 0.545 1.3e-189
UNIPROTKB|F1N2P3 759 ERCC2 "TFIIH basal transcripti 0.993 0.826 0.545 2e-189
UNIPROTKB|P18074 760 ERCC2 "TFIIH basal transcripti 1.0 0.830 0.543 3.3e-189
RGD|1309109 760 Ercc2 "excision repair cross-c 1.0 0.830 0.541 5.4e-189
UNIPROTKB|Q60452 760 ERCC2 "TFIIH basal transcripti 1.0 0.830 0.541 6.9e-189
TAIR|locus:2014525 UVH6 "ULTRAVIOLET HYPERSENSITIVE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2948 (1042.8 bits), Expect = 3.0e-307, P = 3.0e-307
 Identities = 554/631 (87%), Positives = 599/631 (94%)

Query:     1 MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYV 60
             MIFK+EDVTVYFPYDNIYPEQY YM+ELKRALDAKGHCLLEMPTGTGKTIALLSLITSY 
Sbjct:     1 MIFKIEDVTVYFPYDNIYPEQYEYMVELKRALDAKGHCLLEMPTGTGKTIALLSLITSYR 60

Query:    61 LSKPENPVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSR 120
             LS+P++P+KL+YCTRTVHEMEKTL ELKLLH+YQ RHLG  AKILA+GLSSRKNLCVN++
Sbjct:    61 LSRPDSPIKLVYCTRTVHEMEKTLGELKLLHDYQVRHLGTQAKILALGLSSRKNLCVNTK 120

Query:   121 VLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFENYEKAASAAVLPPGVYTLQDL 180
             VLAAENRDSVDAACRKRTASWVRAL+ ENPN+E C+FFENYEKAA  A+LPPGVYTL+DL
Sbjct:   121 VLAAENRDSVDAACRKRTASWVRALSTENPNVELCDFFENYEKAAENALLPPGVYTLEDL 180

Query:   181 RAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID 240
             RAFGK +GWCPYFLARHM+QFANV+VYSYQYLLDPKVAG ISKE+QKESVVVFDEAHNID
Sbjct:   181 RAFGKNRGWCPYFLARHMIQFANVIVYSYQYLLDPKVAGFISKELQKESVVVFDEAHNID 240

Query:   241 NVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPI 300
             NVCIEALSVSVRR TLEGA RNL++I QEI+RFKATDAGRLRAEYNRLVEGLALRG+L  
Sbjct:   241 NVCIEALSVSVRRVTLEGANRNLNKIRQEIDRFKATDAGRLRAEYNRLVEGLALRGDLSG 300

Query:   301 ADAWLSNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVAS 360
              D WL+NPALP DILKEAVPGNIRRAEHF+HVLRRL+QYL  RL+TENVEKE PVSFV+S
Sbjct:   301 GDQWLANPALPHDILKEAVPGNIRRAEHFVHVLRRLLQYLGVRLDTENVEKESPVSFVSS 360

Query:   361 ITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEP 420
             + + AGI+QKTL+FCY+RL SLMLTLEITDTDEFL IQT+CDFATLVGTY RGFSIIIEP
Sbjct:   361 LNSQAGIEQKTLKFCYDRLQSLMLTLEITDTDEFLPIQTVCDFATLVGTYARGFSIIIEP 420

Query:   421 FDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS 480
             +DERMPHIPDP+LQLSCHDASLA+KPVFDRFQSVVITSGTLSPIDLYPRLLNF PVVSRS
Sbjct:   421 YDERMPHIPDPILQLSCHDASLAIKPVFDRFQSVVITSGTLSPIDLYPRLLNFTPVVSRS 480

Query:   481 FKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFV 540
             FKMS+TRDCICPMVLTRGSDQLPVSTKFDMRSDPGV RNYGKLLVEMVSIVPDG+VCFFV
Sbjct:   481 FKMSMTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVVRNYGKLLVEMVSIVPDGVVCFFV 540

Query:   541 SYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVA 600
             SYSYMD IIATWN++GILKEIMQ KLVFIETQDVVETTLALDNYR+ACDCGRGAVFFSVA
Sbjct:   541 SYSYMDGIIATWNETGILKEIMQQKLVFIETQDVVETTLALDNYRRACDCGRGAVFFSVA 600

Query:   601 RGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK 631
             RGKVAEGIDFDRHYGRLV+M+GVPFQYTLSK
Sbjct:   601 RGKVAEGIDFDRHYGRLVVMYGVPFQYTLSK 631
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006139 "nucleobase-containing compound metabolic process" evidence=IEA
GO:0006289 "nucleotide-excision repair" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0016817 "hydrolase activity, acting on acid anhydrides" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
GO:0006281 "DNA repair" evidence=IMP
GO:0009408 "response to heat" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0010212 "response to ionizing radiation" evidence=RCA
GO:0010286 "heat acclimation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0009411 "response to UV" evidence=IMP
ZFIN|ZDB-GENE-040426-997 ercc2 "excision repair cross-complementing rodent repair deficiency, complementation group 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q91941 ERCC2/XPD "ERCC2/XPD protein" [Xiphophorus maculatus (taxid:8083)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWT1 ERCC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLJ0 ERCC2 "TFIIH basal transcription factor complex helicase XPD subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMH9 ERCC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2P3 ERCC2 "TFIIH basal transcription factor complex helicase XPD subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P18074 ERCC2 "TFIIH basal transcription factor complex helicase XPD subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309109 Ercc2 "excision repair cross-complementing rodent repair deficiency, complementation group 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q60452 ERCC2 "TFIIH basal transcription factor complex helicase XPD subunit" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P18074ERCC2_HUMAN3, ., 6, ., 4, ., 1, 20.54351.00.8302yesno
O08811ERCC2_MOUSE3, ., 6, ., 4, ., 1, 20.54351.00.8302yesno
P06839RAD3_YEAST3, ., 6, ., 4, ., 1, 20.47310.99840.8097yesno
Q8W4M7ERCC2_ARATH3, ., 6, ., 4, ., 1, 20.87791.00.8324yesno
A6QLJ0ERCC2_BOVIN3, ., 6, ., 4, ., 1, 20.54351.00.8302yesno
P26659RAD15_SCHPO3, ., 6, ., 4, ., 1, 20.51660.99840.8160yesno
Q55G81ERCC2_DICDI3, ., 6, ., 4, ., 1, 20.53790.98730.8028yesno
Q60452ERCC2_CRIGR3, ., 6, ., 4, ., 1, 20.54191.00.8302yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.979
3rd Layer3.6.40.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00020503
hypothetical protein (758 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_LG_I000900
hypothetical protein (803 aa)
    ••• 0.959
estExt_fgenesh4_pm.C_1650003
hypothetical protein (413 aa)
   •••• 0.953
gw1.V.5266.1
hypothetical protein (289 aa)
   •••• 0.853
estExt_fgenesh4_pg.C_LG_IV0538
hypothetical protein (449 aa)
   •••• 0.836
estExt_Genewise1_v1.C_1330021
hypothetical protein (334 aa)
    ••• 0.799
gw1.V.2541.1
hypothetical protein (1081 aa)
   •• • 0.686
gw1.70.559.1
hypothetical protein (329 aa)
   • •• 0.639
eugene3.00290111
hypothetical protein (982 aa)
     •• 0.619
fgenesh4_pg.C_LG_I002797
hypothetical protein (1088 aa)
   • •• 0.607
estExt_Genewise1_v1.C_LG_IV2251
hypothetical protein (909 aa)
     •• 0.568

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
TIGR00604705 TIGR00604, rad3, DNA repair helicase (rad3) 0.0
smart00488289 smart00488, DEXDc2, DEAD-like helicases superfamil 1e-114
COG1199654 COG1199, DinG, Rad3-related DNA helicases [Transcr 1e-74
pfam06733168 pfam06733, DEAD_2, DEAD_2 2e-57
pfam06777146 pfam06777, DUF1227, Protein of unknown function (D 2e-56
smart00491142 smart00491, HELICc2, helicase superfamily c-termin 2e-28
pfam13307165 pfam13307, Helicase_C_2, Helicase C-terminal domai 2e-17
PRK11747697 PRK11747, dinG, ATP-dependent DNA helicase DinG; P 0.002
>gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) Back     alignment and domain information 
 Score =  679 bits (1755), Expect = 0.0
 Identities = 287/626 (45%), Positives = 414/626 (66%), Gaps = 6/626 (0%)

Query: 7   DVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPEN 66
           ++ VYFPY+ IYPEQ SYM +LKR+LD     +LEMP+GTGKTI+LLSLI +Y   KPE 
Sbjct: 1   ELLVYFPYEKIYPEQRSYMRDLKRSLDRGDEAILEMPSGTGKTISLLSLILAYQQEKPE- 59

Query: 67  PVKLIYCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAEN 126
             K+IY +RT  ++E+   EL+ L +Y+T  +G  + +  + L+SRKNLC++  V     
Sbjct: 60  VRKIIYASRTHSQLEQATEELRKLMSYRTPRIGEESPVSGLSLASRKNLCLHPEVSKERQ 119

Query: 127 RDSVDAACRKRTASWVRALAAENPNIETCEFFEN-YEKAASAAVLPPGVYTLQDLRAFGK 185
              V+  C K T S ++    E PN+E+CEF+EN  E      +L   +  ++DL  +G+
Sbjct: 120 GKVVNGKCIKLTVSKIKEQRTEKPNVESCEFYENFDELREVEDLLLSEIMDIEDLVEYGE 179

Query: 186 QQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNIDNVCIE 245
             G CPYF  R M+ FAN+V+  YQYLLDPK+   +S E+ K+S+V+FDEAHN+DNVCI 
Sbjct: 180 LLGLCPYFATRKMLPFANIVLLPYQYLLDPKIRSAVSIEL-KDSIVIFDEAHNLDNVCIS 238

Query: 246 ALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWL 305
           +LS ++  ++L+  ++ ++   ++IE  K  DA +L  E  +LVEGL     L   D +L
Sbjct: 239 SLSSNLSVRSLKRCSKEIAEYFEKIEERKEVDARKLLDELQKLVEGLKQEDLLTDEDIFL 298

Query: 306 SNPALPSDILKEAVPGNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHA 365
           +NP LP ++L EAVPGNIR AE FLH L R ++YL+  L+   V  E P +F+  +    
Sbjct: 299 ANPVLPKEVLPEAVPGNIRIAEIFLHKLSRYLEYLKDALKVLGVVSELPDAFLEHLK-EK 357

Query: 366 GIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERM 425
               + LRFC ERL +L+  LEIT  ++F  +  +  FATLV TYT GF   IEP++   
Sbjct: 358 TFIDRPLRFCSERLSNLLRELEITHPEDFSALVLLFTFATLVLTYTNGFLEGIEPYEN-- 415

Query: 426 PHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSL 485
             +P+P+L+  C D S+A+KP+F+R +SV++ SGTLSP+D +PR L F+PV   S    L
Sbjct: 416 KTVPNPILKFMCLDPSIALKPLFERVRSVILASGTLSPLDAFPRNLGFNPVSQDSPTHIL 475

Query: 486 TRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYM 545
            R+ +  +++TRGSDQ+P+S+ F++R+DP + RN G+LLVE   I+PDGIV FF SYSY+
Sbjct: 476 KRENLLTLIVTRGSDQVPLSSTFEIRNDPSLVRNLGELLVEFSKIIPDGIVVFFPSYSYL 535

Query: 546 DEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVA 605
           + I++TW + GIL+ I + KL+F+ET+D  ET+ AL+ Y++A   GRGAV  SVA GKV+
Sbjct: 536 ENIVSTWKEMGILENIEKKKLIFVETKDAQETSDALERYKQAVSEGRGAVLLSVAGGKVS 595

Query: 606 EGIDFDRHYGRLVIMFGVPFQYTLSK 631
           EGIDF    GR VIM G+P++YT S+
Sbjct: 596 EGIDFCDDLGRAVIMVGIPYEYTESR 621

All proteins in this family for which funcitons are known are DNA-DNA helicases that funciton in the initiation of transcription and nucleotide excision repair as part of the TFIIH complex. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 705
>gnl|CDD|214693 smart00488, DEXDc2, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219153 pfam06733, DEAD_2, DEAD_2 Back     alignment and domain information
>gnl|CDD|191608 pfam06777, DUF1227, Protein of unknown function (DUF1227) Back     alignment and domain information
>gnl|CDD|214694 smart00491, HELICc2, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|222037 pfam13307, Helicase_C_2, Helicase C-terminal domain Back     alignment and domain information
>gnl|CDD|236966 PRK11747, dinG, ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 631
KOG1131 755 consensus RNA polymerase II transcription initiati 100.0
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 100.0
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 100.0
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 100.0
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 100.0
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 100.0
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 100.0
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 100.0
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 100.0
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 100.0
smart00489289 DEXDc3 DEAD-like helicases superfamily. 100.0
smart00488289 DEXDc2 DEAD-like helicases superfamily. 100.0
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 99.97
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 99.9
smart00491142 HELICc2 helicase superfamily c-terminal domain. 99.86
smart00492141 HELICc3 helicase superfamily c-terminal domain. 99.8
PF06777146 DUF1227: Protein of unknown function (DUF1227); In 99.71
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.7
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.7
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.69
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.68
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.67
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.67
PTZ00110545 helicase; Provisional 99.66
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.65
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.64
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.64
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.62
PTZ00424401 helicase 45; Provisional 99.61
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.6
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.56
PRK13767 876 ATP-dependent helicase; Provisional 99.56
PRK09401 1176 reverse gyrase; Reviewed 99.54
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.53
PRK01172674 ski2-like helicase; Provisional 99.48
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.47
PRK02362 737 ski2-like helicase; Provisional 99.46
PRK00254720 ski2-like helicase; Provisional 99.42
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 99.41
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.41
PRK14701 1638 reverse gyrase; Provisional 99.4
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.39
PRK106891147 transcription-repair coupling factor; Provisional 99.37
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.35
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.33
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.26
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.26
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.26
PHA02653675 RNA helicase NPH-II; Provisional 99.25
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.21
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.21
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.2
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.17
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.17
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.16
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.09
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.03
smart00487201 DEXDc DEAD-like helicases superfamily. 98.98
KOG0343 758 consensus RNA Helicase [RNA processing and modific 98.95
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.95
PRK09694878 helicase Cas3; Provisional 98.89
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.87
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.86
COG1204 766 Superfamily II helicase [General function predicti 98.85
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 98.84
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 98.82
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.8
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.77
PRK05580679 primosome assembly protein PriA; Validated 98.72
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.71
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 98.71
PHA02558501 uvsW UvsW helicase; Provisional 98.68
COG1205 851 Distinct helicase family with a unique C-terminal 98.65
PRK13766 773 Hef nuclease; Provisional 98.65
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.65
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.62
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.61
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 98.6
KOG0354746 consensus DEAD-box like helicase [General function 98.6
PRK04914 956 ATP-dependent helicase HepA; Validated 98.6
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.56
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.55
KOG0346569 consensus RNA helicase [RNA processing and modific 98.53
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.53
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.47
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.43
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.41
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 98.39
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 98.34
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 98.32
TIGR00595505 priA primosomal protein N'. All proteins in this f 98.32
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.27
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 98.24
COG4889 1518 Predicted helicase [General function prediction on 98.23
COG1202830 Superfamily II helicase, archaea-specific [General 98.07
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 98.03
PF1324576 AAA_19: Part of AAA domain 98.02
COG4096875 HsdR Type I site-specific restriction-modification 98.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 98.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 97.98
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 97.95
KOG0334997 consensus RNA helicase [RNA processing and modific 97.87
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.83
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.78
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.7
COG11971139 Mfd Transcription-repair coupling factor (superfam 97.7
KOG1803649 consensus DNA helicase [Replication, recombination 97.68
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 97.61
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.6
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.59
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.58
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.47
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.38
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.17
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 97.11
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.1
KOG4284 980 consensus DEAD box protein [Transcription] 97.08
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.06
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 97.06
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.04
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.02
KOG18051100 consensus DNA replication helicase [Replication, r 96.93
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 96.84
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 96.84
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 96.84
TIGR00376637 DNA helicase, putative. The gene product may repre 96.57
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 96.43
KOG0347731 consensus RNA helicase [RNA processing and modific 96.34
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.29
COG0556663 UvrB Helicase subunit of the DNA excision repair c 96.27
PRK15483 986 type III restriction-modification system StyLTI en 96.22
KOG0327397 consensus Translation initiation factor 4F, helica 96.12
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 96.09
CHL00122 870 secA preprotein translocase subunit SecA; Validate 96.08
KOG0353695 consensus ATP-dependent DNA helicase [General func 96.08
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 96.05
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 95.91
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 95.83
PRK10536262 hypothetical protein; Provisional 95.82
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 95.74
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 95.65
PRK08181269 transposase; Validated 95.56
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.56
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.48
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 95.46
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.37
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.33
PRK12326764 preprotein translocase subunit SecA; Reviewed 95.21
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.2
PHA02244383 ATPase-like protein 95.19
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.04
PRK06835329 DNA replication protein DnaC; Validated 94.98
smart0049082 HELICc helicase superfamily c-terminal domain. 94.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 94.9
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 94.88
PRK05298652 excinuclease ABC subunit B; Provisional 94.85
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 94.69
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 94.49
COG0714329 MoxR-like ATPases [General function prediction onl 94.45
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.38
KOG1123776 consensus RNA polymerase II transcription initiati 94.34
KOG0387 923 consensus Transcription-coupled repair protein CSB 94.34
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 94.3
PRK13531498 regulatory ATPase RavA; Provisional 94.3
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 94.16
PHA02558501 uvsW UvsW helicase; Provisional 94.11
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 93.92
PRK08939306 primosomal protein DnaI; Reviewed 93.87
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 93.76
PRK14873665 primosome assembly protein PriA; Provisional 93.74
PRK06526254 transposase; Provisional 93.53
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.52
PRK12377248 putative replication protein; Provisional 93.51
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 93.45
PRK06921266 hypothetical protein; Provisional 93.4
PRK09183259 transposase/IS protein; Provisional 93.27
KOG0347 731 consensus RNA helicase [RNA processing and modific 93.11
PRK07952244 DNA replication protein DnaC; Validated 92.89
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 92.85
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 92.63
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 92.56
PRK13766 773 Hef nuclease; Provisional 92.29
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 92.05
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 91.9
KOG1002791 consensus Nucleotide excision repair protein RAD16 91.76
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 91.72
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 91.65
PRK08116268 hypothetical protein; Validated 91.3
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 91.29
PRK13407334 bchI magnesium chelatase subunit I; Provisional 91.28
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.23
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 91.21
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 91.19
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 90.99
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 90.96
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 90.94
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 90.79
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 90.75
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 90.7
PRK05298 652 excinuclease ABC subunit B; Provisional 90.65
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 90.43
PRK05642234 DNA replication initiation factor; Validated 90.41
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 90.39
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 90.28
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 90.24
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.23
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 90.21
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 90.18
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.14
smart00382148 AAA ATPases associated with a variety of cellular 90.13
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.12
COG3973747 Superfamily I DNA and RNA helicases [General funct 89.98
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 89.93
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 89.89
PRK13889988 conjugal transfer relaxase TraA; Provisional 89.87
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 89.79
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 89.77
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 89.71
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 89.64
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 89.59
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 89.5
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 89.48
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 89.47
PRK05973237 replicative DNA helicase; Provisional 89.47
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 89.41
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 89.37
PRK08727233 hypothetical protein; Validated 89.3
PRK10875615 recD exonuclease V subunit alpha; Provisional 89.26
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 88.99
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 88.94
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 88.91
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 88.79
PRK08533230 flagellar accessory protein FlaH; Reviewed 88.74
PRK13833323 conjugal transfer protein TrbB; Provisional 88.68
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 88.62
PRK11331459 5-methylcytosine-specific restriction enzyme subun 88.54
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 88.41
COG1204 766 Superfamily II helicase [General function predicti 88.31
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.3
COG1202 830 Superfamily II helicase, archaea-specific [General 88.28
PRK08903227 DnaA regulatory inactivator Hda; Validated 88.14
COG4098441 comFA Superfamily II DNA/RNA helicase required for 88.01
COG0606490 Predicted ATPase with chaperone activity [Posttran 87.94
PRK13851344 type IV secretion system protein VirB11; Provision 87.87
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 87.68
PRK12402337 replication factor C small subunit 2; Reviewed 87.6
COG0610962 Type I site-specific restriction-modification syst 87.59
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 87.31
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 87.2
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 87.14
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 87.1
PRK06067234 flagellar accessory protein FlaH; Validated 87.06
PLN03025319 replication factor C subunit; Provisional 86.99
PRK08084235 DNA replication initiation factor; Provisional 86.86
COG1205 851 Distinct helicase family with a unique C-terminal 86.84
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 86.71
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 86.68
PF07726131 AAA_3: ATPase family associated with various cellu 86.61
PRK06893229 DNA replication initiation factor; Validated 86.58
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 86.58
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 86.44
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 86.41
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 86.39
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 86.29
PRK14087450 dnaA chromosomal replication initiation protein; P 86.13
KOG0745564 consensus Putative ATP-dependent Clp-type protease 86.08
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 86.04
PHA02533534 17 large terminase protein; Provisional 86.03
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 85.97
COG3587 985 Restriction endonuclease [Defense mechanisms] 85.93
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 85.87
PRK11054684 helD DNA helicase IV; Provisional 85.76
PHA02544316 44 clamp loader, small subunit; Provisional 85.69
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 85.37
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 85.32
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 85.23
PHA00729226 NTP-binding motif containing protein 85.19
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 85.18
PRK11608326 pspF phage shock protein operon transcriptional ac 85.17
COG0593408 DnaA ATPase involved in DNA replication initiation 85.07
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 84.96
PRK10646153 ADP-binding protein; Provisional 84.9
TIGR02928365 orc1/cdc6 family replication initiation protein. M 84.89
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 84.87
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 84.86
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 84.85
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 84.71
PRK13765637 ATP-dependent protease Lon; Provisional 84.59
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 84.55
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 84.45
PRK13826 1102 Dtr system oriT relaxase; Provisional 84.26
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 84.23
KOG18071025 consensus Helicases [Replication, recombination an 84.17
PRK12422445 chromosomal replication initiation protein; Provis 84.09
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 84.01
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 83.88
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.79
PRK00440319 rfc replication factor C small subunit; Reviewed 83.76
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 83.67
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 83.66
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 83.19
PRK00411394 cdc6 cell division control protein 6; Reviewed 83.08
PRK04328249 hypothetical protein; Provisional 83.0
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 82.98
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 82.96
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 82.93
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 82.9
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 82.88
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 82.52
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 82.25
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 82.21
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 82.09
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 82.07
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 82.06
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 81.89
TIGR00362405 DnaA chromosomal replication initiator protein Dna 81.83
TIGR02974329 phageshock_pspF psp operon transcriptional activat 81.52
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 81.44
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 81.36
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 81.34
PRK00149450 dnaA chromosomal replication initiation protein; R 81.22
KOG4439901 consensus RNA polymerase II transcription terminat 81.19
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 81.15
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 81.08
TIGR01817534 nifA Nif-specific regulatory protein. This model r 81.07
PRK09694 878 helicase Cas3; Provisional 80.94
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 80.93
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 80.79
TIGR00609 1087 recB exodeoxyribonuclease V, beta subunit. All pro 80.74
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 80.37
COG0802149 Predicted ATPase or kinase [General function predi 80.36
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 80.31
COG2256436 MGS1 ATPase related to the helicase subunit of the 80.3
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 80.26
COG1126240 GlnQ ABC-type polar amino acid transport system, A 80.03
PRK09361225 radB DNA repair and recombination protein RadB; Pr 80.01
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-110  Score=827.49  Aligned_cols=626  Identities=63%  Similarity=1.081  Sum_probs=596.4

Q ss_pred             CeEEEcCeEeeCCCCCCChHHHHHHHHHHHHHhcCCcEEEecCCCChhHHHHHHHHHHHHhhCCCCCceEEEEecchhhH
Q 006790            1 MIFKLEDVTVYFPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEM   80 (631)
Q Consensus         1 ~~~~i~~~~~~Fpy~~~r~~Q~~~~~~v~~~l~~~~~~~iEapTGtGKTla~L~~~l~~~~~~~~~~~~vi~~t~T~~l~   80 (631)
                      |+|.|+|+.|+|||...||+|.++|..+.++|+.++|.++|.|+|||||.+.|.-.++|....|+...|+|||+||...+
T Consensus         1 Mk~~id~l~v~FPY~~iYPEQ~~YM~elKrsLDakGh~llEMPSGTGKTvsLLSli~aYq~~~p~~~~KliYCSRTvpEi   80 (755)
T KOG1131|consen    1 MKFYIDDLLVYFPYDYIYPEQYEYMRELKRSLDAKGHCLLEMPSGTGKTVSLLSLIIAYQLHYPDEHRKLIYCSRTVPEI   80 (755)
T ss_pred             CeeeecCeeEecCCcccCHHHHHHHHHHHHhhccCCcEEEECCCCCCcchHHHHHHHHHHHhCCcccceEEEecCcchHH
Confidence            99999999999999999999999999999999999999999999999999999999999999885444999999999999


Q ss_pred             HHHHHHHHhhhhhcccCCCCccceeEEEeCCCCccccChhhhcccCcchHHHHHHHhhhHHHHhhhhcCCCCCCCccccc
Q 006790           81 EKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVDAACRKRTASWVRALAAENPNIETCEFFEN  160 (631)
Q Consensus        81 ~Q~~~el~~l~~~~~~~~~~~~~~~~~~l~gr~~lC~~~~~~~~~~~~~~~~~c~~l~~~w~~~~~~g~~~~~~c~~~~~  160 (631)
                      +..++||+++..|..+++|.+.++..+.|.||.|+|+|+.+....++..++..|+.+..+|+++....|++...|.||++
T Consensus        81 eK~l~El~~l~~y~~k~~g~~~~flglglssRKNlCi~~~v~~~r~g~~VD~~Cr~ltas~vr~~~~ed~~~~~C~f~en  160 (755)
T KOG1131|consen   81 EKALEELKRLMDYREKHLGYPEPFLGLGLSSRKNLCIHPEVLKERNGNVVDAACRKLTASYVRAKLAEDPNVELCDFFEN  160 (755)
T ss_pred             HHHHHHHHHHHHHHHHhcCCCCceeeeeeccccccccCHHHHHHhcCCchhHHHHHHhHHHHHHHHhcCCCcchhhHHhh
Confidence            99999999999999999888899999999999999999999888888899999999999999998888887788999999


Q ss_pred             hHHhhhcCCCCCCCCChHHHHHhcccCCccchhhHHhhccCceEEEEcCccccCHhhHhHhhhccCCCcEEEEeCCcchH
Q 006790          161 YEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEMQKESVVVFDEAHNID  240 (631)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Cpy~~~r~~~~~adivv~n~~~l~~~~~~~~~~~~l~~~~~~IiDEAHnl~  240 (631)
                      +..  .+..+|.++|+.+++++.|...+.||||.+|.....|+|||-+|+||+||.+.+.+...+.+.++||||||||++
T Consensus       161 ~~~--~~~~lp~gvy~~~dL~~~g~~k~~CPYflaR~~I~~~nvivYsYhYllDPkIa~~VSkels~~svVvFDEAHNID  238 (755)
T KOG1131|consen  161 LED--KESLLPVGVYTLEDLKEYGEKKGWCPYFLARRMIPFANVIVYSYHYLLDPKIAELVSKELSKESVVVFDEAHNID  238 (755)
T ss_pred             hhc--ccccCCcccccHHHHHHhhhcCCcChHHHHHHhhhcccEEEEehhhhcChHHHHHHHHhhCcCcEEEeccccccc
Confidence            876  234688999999999999999999999999999999999999999999999988777888899999999999999


Q ss_pred             HHHHhhccceecHHHHHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHHhhcCCCccccccccCCCCChhhhhhccC
Q 006790          241 NVCIEALSVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILKEAVP  320 (631)
Q Consensus       241 ~~a~~~~s~~ls~~~l~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (631)
                      .+|.+.+|..++...++++.+.+..+.+.+.+++..+.++|+.++++++++|+......+.+.+++||.+|++++.+.+|
T Consensus       239 nvCIeslSv~i~r~~l~ra~~~l~~l~~~v~r~k~~d~~kl~~eY~klvegL~~~~~~~~~d~~lanPvLP~dvl~EavP  318 (755)
T KOG1131|consen  239 NVCIESLSVDITRRTLERASRNLNSLEQLVNRVKETDSQKLQDEYEKLVEGLKDASAERDEDQFLANPVLPDDVLKEAVP  318 (755)
T ss_pred             chhhhhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhcchhHHHHHHHHHHHHhhccccccCccchhcCCCCchhhhhhhCC
Confidence            99999999999999999999999999888888888888999999999999998876666667899999999999999999


Q ss_pred             cchhchHHHHHHHHHHHHHHHhhhhcccccccChhHHHHHHHhhhccccchhhhhHHHHHHHHHHhhhcCCCccchhHHH
Q 006790          321 GNIRRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTI  400 (631)
Q Consensus       321 ~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~~~~~~~~~l~~~  400 (631)
                      |+|+++++|+.++++++++++.+++..++..++|..|++.+.+...++.++++||.+||++++.+|+....++|.+++.+
T Consensus       319 GniR~aeHFv~fLkR~~ey~ktrl~~~hv~~Esp~sFl~~i~~~~~IerKplrFCaeRL~~L~~tLeitd~~df~~l~~v  398 (755)
T KOG1131|consen  319 GNIRRAEHFVSFLKRLLEYLKTRLKVHHVIQESPASFLKSIKSLTFIERKPLRFCAERLSSLVRTLEITDVEDFGALKTV  398 (755)
T ss_pred             cchhhHHHHHHHHHHHHHHHHHhhhheeeeccCcHHHHHHHHHhhhhhccchHHHHHHHHHHHHHhccCchhhhhHHHHH
Confidence            99999999999999999999999999899999999999999999999999999999999999999999988999999999


Q ss_pred             HHHHHHhcccCCceEEEEecCCCCCCCCCCCeEEEEecCcccccHHHhhccCEEEEecCCCCCccchhhhcCCCCccccc
Q 006790          401 CDFATLVGTYTRGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS  480 (631)
Q Consensus       401 ~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~l~~l~~~~~svIltSaTL~p~~~f~~~lG~~~~~~~~  480 (631)
                      .+|.++..+|.++|.+++||.+.+.++..+++|+++|+|.|.+++++|++++|||.|||||+|.+.+-++|.+.+....+
T Consensus       399 ~~faTlVstY~kGF~iIiEPfd~~~~tv~npil~~sClDaSiAikPVf~RFqsViITSGTlspldmyPk~lnf~pv~~~s  478 (755)
T KOG1131|consen  399 ADFATLVSTYSKGFSIIIEPFDDRNPTVPNPILRFSCLDASIAIKPVFERFQSVIITSGTLSPLDMYPKILNFGPVVGAS  478 (755)
T ss_pred             HHHHHHHHHHhcCcEEEEcccccCCCCCCCCeeEEeecccchhhhHHHHhhheEEEecCcccccccCchhhccCcccchh
Confidence            99999999999999999999998888888999999999999999999999999999999999999999999999988888


Q ss_pred             cceeecCCceeeEEeeeCCCCcceeeeeccCCCHHHHHHHHHHHHHhhcccCCcEEEEecchHHHHHHHHHHhhcchHHH
Q 006790          481 FKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKE  560 (631)
Q Consensus       481 ~~~~~~~~~~~~~vi~~~~~~~~l~s~f~~r~~~~~~~~l~~~i~~~~~~~~gg~LVfF~Sy~~l~~v~~~~~~~~~~~~  560 (631)
                      +.....++++.|+++++|.++..+++.|+-|+++....++|+.+.+..+.+|||+.+|||||-+|+.+...|...|++++
T Consensus       479 ~~mtLaR~c~~PmiitrG~Dqv~iss~fe~r~d~~VvrnyG~llve~sk~vpdG~v~ff~sylYmesiv~~w~~~gil~e  558 (755)
T KOG1131|consen  479 FTMTLARNCLLPLIITRGNDQVAISSKFEARGDPSVVRNYGNLLVEMSKIVPDGIVCFFPSYLYMESIVSRWYEQGILDE  558 (755)
T ss_pred             hheecccccccceeeecCCcchhhhhhhhhccChHHHhhcCcceeeecccCCCceEEEEehHHHHHHHHHHHHHHhHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCeEEEeCCCchhhHHHHHHHHHhhcCCCCeEEEEEecCcccccccCCCCCceEEEEEcccCCCC
Q 006790          561 IMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYT  628 (631)
Q Consensus       561 l~~~~~v~~e~~~~~~~~~~l~~fk~~~~~~~~aILfgv~~Gsf~EGIDf~g~~lr~VII~gLPfp~p  628 (631)
                      ++++|.+|+|.++..+++..+++|+++|+.|+|||||.|+||+.+|||||...+.|+||+.|+||...
T Consensus       559 i~k~KL~fIetpD~~ETs~al~ny~~aC~~gRGavl~sVargkVsEgidF~hhyGR~ViM~gIP~qyt  626 (755)
T KOG1131|consen  559 IMKYKLLFIETPDFRETSLALANYRYACDNGRGAVLLSVARGKVSEGIDFDHHYGREVIMEGIPYQYT  626 (755)
T ss_pred             HhhCceEEEeCCchhhhHHHHHHHHHHhcCCCCceEEEEecCccccCcccccccCceEEEEeccchhh
Confidence            99999999999999899999999999999999999999999999999999999999999999999754

>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF06777 DUF1227: Protein of unknown function (DUF1227); InterPro: IPR010643 This domain represents a conserved region within a number of eukaryotic DNA repair helicases Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
4a15_A620 Crystal Structure Of An Xpd Dna Complex Length = 62 2e-15
2vsf_A602 Structure Of Xpd From Thermoplasma Acidophilum Leng 4e-15
3crv_A551 "xpd_helicase" Length = 551 1e-04
>pdb|4A15|A Chain A, Crystal Structure Of An Xpd Dna Complex Length = 620 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 134/625 (21%), Positives = 249/625 (39%), Gaps = 139/625 (22%)
Query: 28  LKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAEL 87
           L+ +L       LE PTG+GKTI  L     Y     E  +K++Y  RT  + E+ + EL
Sbjct: 15  LRSSLQKSYGVALESPTGSGKTIMALKSALQY---SSERKLKVLYLVRTNSQEEQVIKEL 71
Query: 88  KLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRV---LAAENRDSVDAACRKRTASWVRA 144
                   R L    KI AI +  R N+C+  R+   L   N +S+   C  +     R 
Sbjct: 72  --------RSLSSTMKIRAIPMQGRVNMCILYRMVDDLHEINAESLAKFCNMKK----RE 119
Query: 145 LAAENPNIETCEFFE-NYEKAASAAVLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFAN 203
           + A N     C +F        +   L   + T ++   +G++   CPY   +  +  A+
Sbjct: 120 VMAGNE--AACPYFNFKIRSDETKRFLFDELPTAEEFYDYGERNNVCPYESMKAALPDAD 177
Query: 204 VVVYSYQYLLDPKVA-------GIISKEMQKESVVVFDEAHNIDNVCIEALSVSVRRQTL 256
           +V+  Y Y L+  VA       G+   ++    V++ DEAHN+ ++     S+   R ++
Sbjct: 178 IVIAPYAYFLNRSVAEKFLSHWGVSRNQI----VIILDEAHNLPDI---GRSIGSFRISV 230
Query: 257 EGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSNPALPSDILK 316
           E    +L+R ++E + +   +  + +   + L+E              +   AL S + +
Sbjct: 231 E----SLNRADREAQAYGDPELSQ-KIHVSDLIE--------------MIRSALQSMVSE 271
Query: 317 EAVPGNIR-RAEHFLHVLRRLVQ-------------YLRGRLETENVEKEG--PVSFVAS 360
               G++R R + F+  +R + +             YL G       EK G  P S+ +S
Sbjct: 272 RCGKGDVRIRFQEFMEYMRIMNKRSEREIRSLLNYLYLFGEYVENEKEKVGKVPFSYCSS 331
Query: 361 ITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEP 420
           + +                      +  +D DE                    ++ I+ P
Sbjct: 332 VASR--------------------IIAFSDQDE------------------EKYAAILSP 353
Query: 421 FDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRS 480
            D          +Q +C D S  ++ +  +    +  SGTL P D Y  +  F     + 
Sbjct: 354 ED-------GGYMQAACLDPSGILEVL--KESKTIHMSGTLDPFDFYSDITGFEIPFKKI 404
Query: 481 FKMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFV 540
            +       I P      +    VS+K+D   +  + R    ++ +++  V    + +F 
Sbjct: 405 GE-------IFPPENRYIAYYDGVSSKYDTLDEKELDR-MATVIEDIILKVKKNTIVYFP 456
Query: 541 SYSYMDEIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVA 600
           SYS MD +     +    + + +++ +     D  E    L  +R+  D G     F+V+
Sbjct: 457 SYSLMDRV----ENRVSFEHMKEYRGI-----DQKELYSMLKKFRR--DHG---TIFAVS 502
Query: 601 RGKVAEGIDFDRHYGRLVIMFGVPF 625
            G+++EGI+F  +   ++I+ G+PF
Sbjct: 503 GGRLSEGINFPGNELEMIILAGLPF 527
>pdb|2VSF|A Chain A, Structure Of Xpd From Thermoplasma Acidophilum Length = 602 Back     alignment and structure
>pdb|3CRV|A Chain A, "xpd_helicase" Length = 551 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 1e-132
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 2e-94
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 1e-88
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 Back     alignment and structure
 Score =  401 bits (1032), Expect = e-132
 Identities = 114/622 (18%), Positives = 227/622 (36%), Gaps = 98/622 (15%)

Query: 12  FPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLI 71
           +        Q   +  L+ +L       LE PTG+GKTI  L     Y     E  +K++
Sbjct: 2   YEN---RQYQVEAIDFLRSSLQKSYGVALESPTGSGKTIMALKSALQYS---SERKLKVL 55

Query: 72  YCTRTVHEMEKTLAELKLLHNYQTRHLGPAAKILAIGLSSRKNLCVNSRVLAAENRDSVD 131
           Y  RT  + E+ + EL+ L +          KI AI +  R N+C+  R++   +  + +
Sbjct: 56  YLVRTNSQEEQVIKELRSLSSTM--------KIRAIPMQGRVNMCILYRMVDDLHEINAE 107

Query: 132 AACRKRTASWVRALAAENPNIETCEFFENYEK-AASAAVLPPGVYTLQDLRAFGKQQGWC 190
           +   K      R + A N     C +F    +   +   L   + T ++   +G++   C
Sbjct: 108 S-LAKFCNMKKREVMAGNE--AACPYFNFKIRSDETKRFLFDELPTAEEFYDYGERNNVC 164

Query: 191 PYFLARHMVQFANVVVYSYQYLLDPKVAGIISKEM---QKESVVVFDEAHNIDNVCIEAL 247
           PY   +  +  A++V+  Y Y L+  VA          + + V++ DEAHN+ ++     
Sbjct: 165 PYESMKAALPDADIVIAPYAYFLNRSVAEKFLSHWGVSRNQIVIILDEAHNLPDIGRSIG 224

Query: 248 SVSVRRQTLEGATRNLSRINQEIERFKATDAGRLRAEYNRLVEGLALRGNLPIADAWLSN 307
           S  +  ++L  A R                    +   + L+E +               
Sbjct: 225 SFRISVESLNRADREAQAYGDPEL--------SQKIHVSDLIEMI--------------R 262

Query: 308 PALPSDILKEAVPGNIR-RAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAG 366
            AL S + +    G++R R + F+  +R + +     + +          +V +      
Sbjct: 263 SALQSMVSERCGKGDVRIRFQEFMEYMRIMNKRSEREIRSLLNYLYLFGEYVEN--EKEK 320

Query: 367 IDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDFATLVGTYTRGFSIIIEPFDERMP 426
           + +    +C      ++   +                          ++ I+ P D    
Sbjct: 321 VGKVPFSYCSSVASRIIAFSD---------------------QDEEKYAAILSPED---- 355

Query: 427 HIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFKMSLT 486
                 +Q +C D S  ++ + +     +  SGTL P D Y  +  F     +  ++   
Sbjct: 356 ---GGYMQAACLDPSGILEVLKES--KTIHMSGTLDPFDFYSDITGFEIPFKKIGEIFPP 410

Query: 487 RDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMD 546
            +               VS+K+D   +  + R    ++ +++  V    + +F SYS MD
Sbjct: 411 ENRYIAYY-------DGVSSKYDTLDEKELDR-MATVIEDIILKVKKNTIVYFPSYSLMD 462

Query: 547 EIIATWNDSGILKEIMQHKLVFIETQDVVETTLALDNYRKACDCGRGAVFFSVARGKVAE 606
            +    +            +      D  E    L  +R+          F+V+ G+++E
Sbjct: 463 RVENRVSF---------EHMKEYRGIDQKELYSMLKKFRR-----DHGTIFAVSGGRLSE 508

Query: 607 GIDFDRHYGRLVIMFGVPFQYT 628
           GI+F  +   ++I+ G+PF   
Sbjct: 509 GINFPGNELEMIILAGLPFPRP 530
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 100.0
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 100.0
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.76
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.75
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.73
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.73
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.72
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.71
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.71
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.7
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.69
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.67
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.66
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.64
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.64
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.63
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.58
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.51
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.51
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.51
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.51
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.51
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.5
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.5
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.5
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.49
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.49
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.48
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.48
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.48
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.48
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.47
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.46
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.45
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.45
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.44
3bor_A237 Human initiation factor 4A-II; translation initiat 99.44
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.42
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.38
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.36
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.36
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.34
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.32
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.3
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.26
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.23
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.22
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.21
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.2
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.16
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.14
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.12
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.1
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.09
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.09
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.06
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.02
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.01
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.01
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.98
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.93
3h1t_A590 Type I site-specific restriction-modification syst 98.91
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.85
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.83
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.79
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.77
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.58
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.57
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.55
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.53
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 98.38
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.19
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.09
1yks_A440 Genome polyprotein [contains: flavivirin protease 98.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 97.99
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 97.96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 97.89
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.84
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 97.79
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.56
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.51
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.46
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 97.42
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.38
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.19
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 97.16
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.03
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.02
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 96.99
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.97
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 95.81
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.62
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 96.4
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.25
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 96.19
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 95.96
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 95.72
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.6
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 95.6
4gl2_A 699 Interferon-induced helicase C domain-containing P; 95.45
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 95.29
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 95.27
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.17
3h1t_A590 Type I site-specific restriction-modification syst 95.04
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.87
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 94.8
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 94.75
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 94.71
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.68
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 94.65
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 94.59
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 94.57
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 94.4
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 94.3
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 94.3
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.19
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 94.11
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 94.05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.83
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.66
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.51
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 93.39
2qgz_A308 Helicase loader, putative primosome component; str 93.23
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 93.23
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.13
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 93.04
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 92.93
1yks_A 440 Genome polyprotein [contains: flavivirin protease 92.92
3co5_A143 Putative two-component system transcriptional RES 92.83
2r44_A331 Uncharacterized protein; putative ATPase, structur 92.76
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 92.63
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 92.54
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 91.8
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.32
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 91.07
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 90.51
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 90.19
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 90.12
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 90.05
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 89.84
3bos_A242 Putative DNA replication factor; P-loop containing 89.64
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 89.57
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 89.5
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 88.94
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.71
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.47
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 88.42
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 88.28
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 87.86
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 87.49
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 87.26
2chg_A226 Replication factor C small subunit; DNA-binding pr 87.22
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 86.85
1ojl_A304 Transcriptional regulatory protein ZRAR; response 86.76
2gno_A305 DNA polymerase III, gamma subunit-related protein; 86.64
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.32
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.2
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 84.99
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 84.97
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 84.88
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 84.88
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 84.81
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 84.64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 84.2
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 84.01
3pvs_A447 Replication-associated recombination protein A; ma 83.88
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 83.71
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 83.7
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 83.69
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 83.67
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 83.59
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 83.51
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 83.44
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 83.43
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 83.22
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 83.06
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 82.98
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 82.45
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 82.36
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 82.3
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 82.15
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 82.11
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 82.05
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 81.94
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 81.76
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 81.47
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 80.46
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 80.34
2r62_A268 Cell division protease FTSH homolog; ATPase domain 80.21
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 80.09
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-78  Score=672.45  Aligned_cols=518  Identities=22%  Similarity=0.326  Sum_probs=348.9

Q ss_pred             CCCCChHHHHHHHHHHHHHhcCCcEEEecCCCChhHHHHHHHHHHHHhhCCCCCceEEEEecchhhHHHHHHHHHhhhhh
Q 006790           14 YDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLHNY   93 (631)
Q Consensus        14 y~~~r~~Q~~~~~~v~~~l~~~~~~~iEapTGtGKTla~L~~~l~~~~~~~~~~~~vi~~t~T~~l~~Q~~~el~~l~~~   93 (631)
                      |++ ||+|++||.+|++++.+++++++|||||||||+|||+|++.++...  ++ ||+|+|||++|+.|+++|++++...
T Consensus         2 ~~~-R~~Q~~~~~~v~~~l~~~~~~~~~apTGtGKT~a~l~p~l~~~~~~--~~-kvli~t~T~~l~~Qi~~el~~l~~~   77 (620)
T 4a15_A            2 YEN-RQYQVEAIDFLRSSLQKSYGVALESPTGSGKTIMALKSALQYSSER--KL-KVLYLVRTNSQEEQVIKELRSLSST   77 (620)
T ss_dssp             ----CHHHHHHHHHHHHHHHHSSEEEEECCTTSCHHHHHHHHHHHHHHHH--TC-EEEEEESSHHHHHHHHHHHHHHHHH
T ss_pred             CCC-CHHHHHHHHHHHHHHHcCCCEEEECCCCCCHHHHHHHHHHHhhhhc--CC-eEEEECCCHHHHHHHHHHHHHHhhc
Confidence            675 9999999999999999999999999999999999999999998754  46 9999999999999999999998642


Q ss_pred             cccCCCCccceeEEEeCCCCcccc-ChhhhcccCcchHHH---HHHHhhhHHHHhhhhcCCCCCCCccccchHHhhhc-C
Q 006790           94 QTRHLGPAAKILAIGLSSRKNLCV-NSRVLAAENRDSVDA---ACRKRTASWVRALAAENPNIETCEFFENYEKAASA-A  168 (631)
Q Consensus        94 ~~~~~~~~~~~~~~~l~gr~~lC~-~~~~~~~~~~~~~~~---~c~~l~~~w~~~~~~g~~~~~~c~~~~~~~~~~~~-~  168 (631)
                              .+++++.++||.++|+ ++.+....+ ...+.   .|..+...|..    +  +...|+||.+.....+. .
T Consensus        78 --------~~~~~~~l~gr~~lC~~~~~~~~~~~-~~~~~~~~~C~~l~~~~~~----~--~~~~C~~~~~~~~~gd~~~  142 (620)
T 4a15_A           78 --------MKIRAIPMQGRVNMCILYRMVDDLHE-INAESLAKFCNMKKREVMA----G--NEAACPYFNFKIRSDETKR  142 (620)
T ss_dssp             --------SCCCEEECCCHHHHCSSHHHHCCCSS-CCHHHHHHHHHHHHHHHHT----T--CTTSSTTCSGGGGCHHHHH
T ss_pred             --------cCeEEEEEECCCcccccChhhhhccc-chhhhHHHHHHHHHhcccc----C--CCCCCCcccccCcccchhH
Confidence                    3688999999999999 987765433 22333   78776654421    1  13579999875321110 0


Q ss_pred             CCCCCCCChHHHHHhcccCCccchhhHHhhccCceEEEEcCccccCHhhHhHhh---hccCCCcEEEEeCCcchHHHHHh
Q 006790          169 VLPPGVYTLQDLRAFGKQQGWCPYFLARHMVQFANVVVYSYQYLLDPKVAGIIS---KEMQKESVVVFDEAHNIDNVCIE  245 (631)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~~Cpy~~~r~~~~~adivv~n~~~l~~~~~~~~~~---~~l~~~~~~IiDEAHnl~~~a~~  245 (631)
                      .+...+++++++.+.|+.++.||||.+|+.+.+|||||+||+|||++.+++.+.   ...|+++++||||||||+|+|++
T Consensus       143 ~l~~~~~die~l~~~~~~~~~CPy~~aR~~~~~ADvVV~ny~ylld~~~r~~~~~~~~i~p~~~ivI~DEAHNL~d~a~~  222 (620)
T 4a15_A          143 FLFDELPTAEEFYDYGERNNVCPYESMKAALPDADIVIAPYAYFLNRSVAEKFLSHWGVSRNQIVIILDEAHNLPDIGRS  222 (620)
T ss_dssp             HHHHHCCCHHHHHHHHHHTTCCHHHHHHHHGGGCSEEEEEHHHHTCHHHHHHHHHHHTCCGGGEEEEETTGGGHHHHHHH
T ss_pred             HhccCCCCHHHHHHHhhhcCCCccHHHHHHhhcCCEEEeCchhhcCHHHHHHHHHhhccCcCCeEEEEECCCchHHHHHH
Confidence            112357899999999999999999999999999999999999999998876432   22468999999999999999999


Q ss_pred             hccceecHHHHHHHHHHHHHHHHHHHHhhh-cchhHHHHHHHHHHHHH-hhcCCCccccccccCCCCChhhhhhccCcch
Q 006790          246 ALSVSVRRQTLEGATRNLSRINQEIERFKA-TDAGRLRAEYNRLVEGL-ALRGNLPIADAWLSNPALPSDILKEAVPGNI  323 (631)
Q Consensus       246 ~~s~~ls~~~l~~~~~~l~~~~~~~~~~~~-~~~~~l~~~~~~l~~~l-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  323 (631)
                      ++|.++|..+|..+.+++..+....  +.. .....+.+.+...++.+ ....         . . ....         +
T Consensus       223 ~~S~~ls~~~l~~~~~~l~~~~~~~--~~~~~~~~~~~~~~~~~l~~~~~~~~---------~-~-~~~~---------~  280 (620)
T 4a15_A          223 IGSFRISVESLNRADREAQAYGDPE--LSQKIHVSDLIEMIRSALQSMVSERC---------G-K-GDVR---------I  280 (620)
T ss_dssp             HHCEEEEHHHHHHHHHHHHHTTCCE--EETTEEHHHHHHHHHHHHHHHHHHHC---------S-S-SCEE---------E
T ss_pred             hhcceeCHHHHHHHHHHHHHHHhhh--hhhhHHHHHHHHHHHHHHHHHHHHhh---------c-c-cccC---------C
Confidence            9999999999999888776532100  000 00111111111111111 0100         0 0 0000         0


Q ss_pred             hchHHHHHHHHHHHHHHHhhhhcccccccChhHHHHHHHhhhccccchhhhhHHHHHHHHHHhhhcCCCccchhHHHHHH
Q 006790          324 RRAEHFLHVLRRLVQYLRGRLETENVEKEGPVSFVASITAHAGIDQKTLRFCYERLHSLMLTLEITDTDEFLHIQTICDF  403 (631)
Q Consensus       324 ~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~~~~~~~~~l~~~~~f  403 (631)
                       ....+...+..+.......+          ..++..+..           ..+.+...   ...........+..+.+|
T Consensus       281 -~~~~l~~~~~~~~~~~~~~l----------~~~~~~l~~-----------~~~~~~~~---~~~~~~~~~~~~~~~~~f  335 (620)
T 4a15_A          281 -RFQEFMEYMRIMNKRSEREI----------RSLLNYLYL-----------FGEYVENE---KEKVGKVPFSYCSSVASR  335 (620)
T ss_dssp             -CTHHHHHHHHHHHTCCHHHH----------HHHHHHHHH-----------HHHHHHHH---HHHTTSCCCCHHHHHHHH
T ss_pred             -ChHHHHHHHHHhhcccHHHH----------HHHHHHHHH-----------HHHHHHhh---ccccccccccHHHHHHHH
Confidence             00111111111100000000          000111100           00000000   000000112234556666


Q ss_pred             HHHhcccC-CceEEEEecCCCCCCCCCCCeEEEEecCcccccHHHhhccCEEEEecCCCCCccchhhhcCCCCccccccc
Q 006790          404 ATLVGTYT-RGFSIIIEPFDERMPHIPDPVLQLSCHDASLAVKPVFDRFQSVVITSGTLSPIDLYPRLLNFHPVVSRSFK  482 (631)
Q Consensus       404 ~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~l~~l~~~~~svIltSaTL~p~~~f~~~lG~~~~~~~~~~  482 (631)
                      +..+.... .++.+|++..+       +..|+++|+||+..|+ +| +++++|||||||+|+++|.+.||++ ....+++
T Consensus       336 l~~~~~~~~~~~~~~~~~~~-------~~~l~~~~l~~~~~l~-~~-~~~~~il~SaTL~p~~~~~~~lGl~-~~~~~~~  405 (620)
T 4a15_A          336 IIAFSDQDEEKYAAILSPED-------GGYMQAACLDPSGILE-VL-KESKTIHMSGTLDPFDFYSDITGFE-IPFKKIG  405 (620)
T ss_dssp             HHHHHTSCTTTEEEEEECGG-------GCEEEEEECCTHHHHG-GG-GGSEEEEEESSCCSHHHHHHHHCCC-CCEEECC
T ss_pred             HHHHhhcCCCCEEEEEEeCC-------CcEEEEEECCHHHHHH-HH-hCCeEEEEccCCCcHHHHHHHhCCC-ceeeecC
Confidence            66553333 26788887543       3689999999999999 99 9999999999999999999999998 5556677


Q ss_pred             eeecCCceeeEEeeeCCCCcceeeeeccCCCHHHHHHHHHHHHHhhcccCCcEEEEecchHHHHHHHHHHhhcchHHHHh
Q 006790          483 MSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVARNYGKLLVEMVSIVPDGIVCFFVSYSYMDEIIATWNDSGILKEIM  562 (631)
Q Consensus       483 ~~~~~~~~~~~vi~~~~~~~~l~s~f~~r~~~~~~~~l~~~i~~~~~~~~gg~LVfF~Sy~~l~~v~~~~~~~~~~~~l~  562 (631)
                      ++|+.++...++++      .++++|+.|+ +.+.+++++.|.++++.+|||+|||||||++|+++++.|+.      + 
T Consensus       406 spf~~~~~~~~~~~------~~~~~~~~r~-~~~~~~~~~~i~~l~~~~~g~~lvlF~Sy~~l~~v~~~l~~------~-  471 (620)
T 4a15_A          406 EIFPPENRYIAYYD------GVSSKYDTLD-EKELDRMATVIEDIILKVKKNTIVYFPSYSLMDRVENRVSF------E-  471 (620)
T ss_dssp             CCSCGGGEEEEEEC------CC-------C-HHHHHHHHHHHHHHHHHHCSCEEEEESCHHHHHHHTSSCCS------C-
T ss_pred             CCCCHHHeEEEEeC------CCCCcCCCCC-HHHHHHHHHHHHHHHHhCCCCEEEEeCCHHHHHHHHHHHHh------c-
Confidence            77777766545432      3567787765 45678999999999999999999999999999999999972      1 


Q ss_pred             cCCeEEEeCCCc--hhhHHHHHHHHHhhcCCCCeEEEEEecCcccccccCCCCCceEEEEEcccCCCCCCC
Q 006790          563 QHKLVFIETQDV--VETTLALDNYRKACDCGRGAVFFSVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSK  631 (631)
Q Consensus       563 ~~~~v~~e~~~~--~~~~~~l~~fk~~~~~~~~aILfgv~~Gsf~EGIDf~g~~lr~VII~gLPfp~p~dP  631 (631)
                       ...   |.++.  .++..++++|+     ++++|||||+||||||||||+|+.||+|||+|||||+|+ |
T Consensus       472 -~~~---~~q~~~~~~~~~ll~~f~-----~~~~vL~~v~~gsf~EGiD~~g~~l~~viI~~lPfp~~~-p  532 (620)
T 4a15_A          472 -HMK---EYRGIDQKELYSMLKKFR-----RDHGTIFAVSGGRLSEGINFPGNELEMIILAGLPFPRPD-A  532 (620)
T ss_dssp             -CEE---CCTTCCSHHHHHHHHHHT-----TSCCEEEEETTSCC--------CCCCEEEESSCCCCCCC-H
T ss_pred             -chh---ccCCCChhHHHHHHHHhc-----cCCcEEEEEecCceeccccCCCCceEEEEEEcCCCCCCC-H
Confidence             112   56653  35677889988     478999999999999999999999999999999999995 6
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.4
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.39
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.37
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.37
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.35
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.33
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.32
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.3
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.3
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.23
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.19
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.18
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.17
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.1
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.05
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.02
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.95
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.87
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.86
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.18
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.9
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.64
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.58
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.57
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.57
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.4
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.33
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.2
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.16
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.15
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.06
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 96.84
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.65
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.64
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.52
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.46
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.15
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.99
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 95.93
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 94.93
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.81
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 93.63
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.4
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.37
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.59
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.54
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.42
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.35
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.54
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.42
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.27
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.83
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.69
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.63
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.61
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 90.27
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.13
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.88
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.59
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 89.05
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.92
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 88.84
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.18
d1svma_362 Papillomavirus large T antigen helicase domain {Si 87.89
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.8
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.52
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.49
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.08
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 86.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.81
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 84.78
d1okkd2207 GTPase domain of the signal recognition particle r 84.77
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 84.15
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 84.14
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.68
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.19
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 82.17
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 81.96
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.74
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 81.54
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 81.48
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 80.67
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 80.61
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 80.49
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.35
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.40  E-value=2.9e-13  Score=127.41  Aligned_cols=75  Identities=12%  Similarity=0.096  Sum_probs=63.4

Q ss_pred             CCCCCCChHHHHHHHHHHHHHhcCCcEEEecCCCChhHHHHHHHHHHHHhhCCCCCceEEEEecchhhHHHHHHHHHhhh
Q 006790           12 FPYDNIYPEQYSYMLELKRALDAKGHCLLEMPTGTGKTIALLSLITSYVLSKPENPVKLIYCTRTVHEMEKTLAELKLLH   91 (631)
Q Consensus        12 Fpy~~~r~~Q~~~~~~v~~~l~~~~~~~iEapTGtGKTla~L~~~l~~~~~~~~~~~~vi~~t~T~~l~~Q~~~el~~l~   91 (631)
                      .+|..|+|.|.+.+..+.    +|+++++.||||||||+||++|.+.......... +++|.++|+.+..|+.++++++.
T Consensus        35 ~g~~~pt~IQ~~aIp~il----~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~-~~lil~PtreLa~Qi~~~~~~l~  109 (222)
T d2j0sa1          35 YGFEKPSAIQQRAIKQII----KGRDVIAQSQSGTGKTATFSISVLQCLDIQVRET-QALILAPTRELAVQIQKGLLALG  109 (222)
T ss_dssp             HTCCSCCHHHHHHHHHHH----TTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSC-CEEEECSSHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCHHHHHHHHHHH----CCCCeEEEcCcchhhhhhhcccccccccccccCc-eeEEecchHHHHHHHHHHHHHHh
Confidence            368878999998776654    5789999999999999999999988765554344 89999999999999999988874
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure