Citrus Sinensis ID: 006835


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MEKFMTPLLLLLCLPLALAGHDYGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVIVPAATPVVTKPSPAPKPKTIPPTKPKTTPAPASSSGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA
cHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcHHcccccccccccCEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEEEEEcccccccccEEEEEECcccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEEc
**KFMTPLLLLLCLPLALAGHDYGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVIV********************************SSGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFMTPLLLLLCLPLALAGHDYGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVIVPAATPVVTKPSPAPKPKTIPPTKPKTTPAPASSSGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endoglucanase 6 confidentQ42059
Endoglucanase 2 Hydrolyzes 1,4-beta-glycosyl linkages of 1,4-beta-glucans and 1,3-1,4-beta-glucans. Possesses broad substrate specificity for hemicelluloses of type II cell walls. Substrate preference is carboxymethyl-cellulose > 1,3-1,4-beta-glucan > lichenan > arabinoxylan > phospho-swollen cellulose > xylan > glucomannan. May participate in lateral root development.probableQ5NAT0
Endoglucanase 19 probableQ8L7I0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.4Cellulase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XFG, chain A
Confidence level:very confident
Coverage over the Query: 18-417,432-491
View the alignment between query and template
View the model in PyMOL
Template: 1TF4, chain A
Confidence level:very confident
Coverage over the Query: 19-358,369-415,430-575
View the alignment between query and template
View the model in PyMOL
Template: 2YIK, chain A
Confidence level:very confident
Coverage over the Query: 21-356,369-416,433-491
View the alignment between query and template
View the model in PyMOL
Template: 3NDZ, chain E
Confidence level:confident
Coverage over the Query: 535-628
View the alignment between query and template
View the model in PyMOL