Citrus Sinensis ID: 006856

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MPGAGKKVVKHSESGKSCFPKKDSGSELIASLKFKKGSKISKSKKLRSKSRCQSKTVNSTLLKRTVAESHSKGAGDDFARSKSISQKNLHIKIDRKGSKNWASSKHKGKNSALVISKGNGEVVDGDGETKKLRKGRSKKRRKEKVELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNQEEEWPSDDSEDDDYNPERRENSCSISRAGTDDDPSSSTSLSWFSDSETFSESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYDEMFGKDASAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYGSEEKYSKVKTAEVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARKVESARQVSGSPRISKESSLETEKKNADVLTLKNSLEETLICSPKSLKKIHPKRIQNQSAVAAASRKISRKELL
ccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccHHccccHHHHHHcccHHHHHHcccccccccccccccccHHHHHHHHHHHHHccc
cccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHccccccccccccccccccccccccccccccEEcccHccccccccccccccccccccccccccccccccccHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccccHccEEEHHcccccccccccEEEEcccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHccHHHHcccccccccccHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHcccccccEEEcHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHccHHHHHHHHHHcccEEEcccHccccccccccccccccccccHccHHHHc
mpgagkkvvkhsesgkscfpkkdsgSELIASLKfkkgskiskskklrsksrcqsktvnsTLLKRTvaeshskgagddfarsksisqknLHIKIdrkgsknwasskhkgknsaLVISkgngevvdgdgetkklrkgrskkrrkEKVELDEASRLQRRTRYLLIKMKLEQNLIDaysgegwkghsrekirPEKELQRAKKQILKCKIGIRDAIRQldslssvgciegsviatdgsvhhEHIICAKCklreafpdndivlcdgtcncafhqkcldppldtesnqgwfckFCECKMEIIESMNahigtsfsvnsnwqdifkeeaafpdgcSALLNqeeewpsddsedddynperrenscsisragtdddpssstslswfsdsetFSESMRWEMesngyknysvdssigsdetsdgeiicgrrqrrtVDYKKLYDEMFGKDASAFeqlsededwgpakrrrkekESDAVNSLMTLYgseekyskVKTAEVkkklpsnakirrsfhrmppnAVEKLRQVFAenelpsriVKENlskelslepekvNKWFKNARYLALKARKVEsarqvsgspriskessleTEKKNADVLTLKNSLEetlicspkslkkihpkriqNQSAVAAASRKISRKELL
mpgagkkvvkhsesgkscfpkkdsgseLIASlkfkkgskiskskklrsksrcqsktvnstllkrtvaeshskgagddfarsksisqknlhikidrkgsknwasskhkgknsalviskgngevvdgdgetkklrkgrskkrrkekveldeasrlqrrtRYLLIKMKLEQNLIDaysgegwkghsrekirpekelqRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSviatdgsvhHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNqeeewpsddsedddynperrenscsisragtdddpssstslswfSDSETFSESMRWEMESNGYKNysvdssigsdetsdgeiicgrrqrrtvDYKKLYDEMFGkdasafeqlsededwgpakrrrkekesdavnslmtlygseekyskvktaevkkklpsnakirrsfhrmppnAVEKLRQVfaenelpsrivkenlskelslepekvnkwfKNARYLALKarkvesarqvsgspriskessletekKNADVLTLKNSLEETLICspkslkkihpkriqnqsavaaasrkisrkell
MPGAGKKVVKHSESGKSCFPKKDSGSELIAslkfkkgskiskskklrsksrcqskTVNSTLLKRTVAESHSKGAGDDFARSKSISQKNLHIKIDRKGSKNWASSKHKGKNSALVISKGNGEVVDGDGETkklrkgrskkrrkekVELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNQeeewpsddsedddynpeRRENSCSISRAGTdddpssstslswfsdsETFSESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYDEMFGKDASAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYGSEEKYSKVKTAEVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARKVESARQVSGSPRISKESSLETEKKNADVLTLKNSLEETLICSPKSLKKIHPKRIQNQSAVAAASRKISRKELL
************************************************************************************************************************************************************TRYLLIKMKLEQNLIDAYSGEGW******************KQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSAL***********************************************************************************IICGRRQRRTVDYKKLYDEMF*********************************************************************************************************VNKWFKNARYLALK****************************************************************************
*************************************************************************************************************************************************************************************************************GIRDAIR***********************HEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAH***********************************************************************************************************************************************************************************************************NAVEKLRQVFAENE****************EPEKVNKWFKN**********************************************************************************L
************************GSELIASLKFK**********************NSTLLKRTVAESHSKGAGDDFARSKSISQKNLHIKIDRK**************SALVISKGNGEVVD*************************ASRLQRRTRYLLIKMKLEQNLIDAYSGE********KIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNQ**************************************************ESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYDEMFGKDASAFEQLS******************AVNSLMTLYGSEEKYSKVKTAEVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKAR****************************VLTLKNSLEETLICSPKSLKKI************************
************************************************************************************************************************************************VELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFP*******************************************************************************************CGRRQRRTVDYKKLYDEMFGK***************************************************************FHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARKVE*********************KNADVLTLKNSLEETLICSPKSLK**************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGAGKKVVKHSESGKSCFPKKDSGSELIASLKFKKGSKISKSKKLRSKSRCQSKTVNSTLLKRTVAESHSKGAGDDFARSKSISQKNLHIKIDRKGSKNWASSKHKGKNSALVISKGNGEVVDGDGETKKLRKGRSKKRRKEKVELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNQEEEWPSDDSEDDDYNPERRENSCSISRAGTDDDPSSSTSLSWFSDSETFSESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYDEMFGKDASAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYGSEEKYSKVKTAEVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARKVESARQVSGSPRISKESSLETEKKNADVLTLKNSLEETLICSPKSLKKIHPKRIQNQSAVAAASRKISRKELL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query628 2.2.26 [Sep-21-2011]
P48785 796 Pathogenesis-related home yes no 0.676 0.533 0.582 1e-136
Q04996723 Homeobox protein HAT3.1 O no no 0.297 0.258 0.479 3e-48
P46605 719 Homeobox protein HOX1A OS N/A no 0.300 0.262 0.440 4e-46
P487861088 Pathogenesis-related home N/A no 0.640 0.369 0.298 1e-44
Q96BD5680 PHD finger protein 21A OS yes no 0.093 0.086 0.343 9e-05
P87233461 SWM histone demethylase c yes no 0.167 0.227 0.283 0.0002
Q09908538 SWM histone demethylase c no no 0.074 0.087 0.423 0.0002
Q8NEZ4 4911 Histone-lysine N-methyltr no no 0.122 0.015 0.326 0.0004
Q6ZPK0659 PHD finger protein 21A OS no no 0.093 0.089 0.328 0.0004
Q8BRH4 4903 Histone-lysine N-methyltr no no 0.122 0.015 0.326 0.0004
>sp|P48785|PRH_ARATH Pathogenesis-related homeodomain protein OS=Arabidopsis thaliana GN=PRH PE=2 SV=1 Back     alignment and function desciption
 Score =  486 bits (1251), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 328/443 (74%), Gaps = 18/443 (4%)

Query: 139 KRRKEKVELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKK 198
           +++  KVE+D++ RLQRRTRYLLIKMK++QNLIDAY+ EGWKG SREKIRP+KEL+RA+K
Sbjct: 91  QQKDNKVEVDDSLRLQRRTRYLLIKMKMQQNLIDAYATEGWKGQSREKIRPDKELERARK 150

Query: 199 QILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLC 258
           +IL CK+G+RDAIRQLD LSSVG +E  VIA+DGS+HH+HI CA+C  REAFPDNDI+LC
Sbjct: 151 EILNCKLGLRDAIRQLDLLSSVGSMEEKVIASDGSIHHDHIFCAECNSREAFPDNDIILC 210

Query: 259 DGTCNCAFHQKCLDPPLDTES----NQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQD 314
           DGTCN AFHQKCLDPPL+TES    +QGWFCKFC+CK+EII++MNA IGT F V+SNWQD
Sbjct: 211 DGTCNRAFHQKCLDPPLETESIPPGDQGWFCKFCDCKIEIIDTMNAQIGTHFPVDSNWQD 270

Query: 315 IFKEEAAFPDGCSALLNQEEEWPSDDSEDDDYNPERRE----NSCSISRAGTDDDPSSST 370
           IF EEA+ P G  A +N E +WPSDDS+DDDY+PE RE    NS ++S  G  D+   S 
Sbjct: 271 IFNEEASLPIGSEATVNNEADWPSDDSKDDDYDPEMRENGGGNSSNVSGDGGGDNDEESI 330

Query: 371 SLSWFSDSETFSESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYD 430
           S S    S+  +      + +  ++ + + + +   ETS+ E +CG RQRRTVDY +LY 
Sbjct: 331 STSLSLSSDGVA------LSTGSWEGHRLSNMVEQCETSNEETVCGPRQRRTVDYTQLYY 384

Query: 431 EMFGKDASAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYGSEEKYSKV----KTAEVK 486
           EMFGKDA   EQ SEDEDWGP  RR++++ESDA ++L+T+  S +K   V    + +E  
Sbjct: 385 EMFGKDAVLQEQGSEDEDWGPNDRRKRKRESDAGSTLVTMCESSKKDQDVVETLEQSERD 444

Query: 487 KKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNA 546
                N   RR   R+P NAVEKLRQVFAE ELPS+ V++ L+KELSL+PEKVNKWFKN 
Sbjct: 445 SVSVENKGGRRRMFRLPRNAVEKLRQVFAETELPSKAVRDRLAKELSLDPEKVNKWFKNT 504

Query: 547 RYLALKARKVESARQVSGSPRIS 569
           RY+AL+ RK ES +Q   S  +S
Sbjct: 505 RYMALRNRKTESVKQPGDSKTVS 527
Specifically binds to the fungal elicitor-responsive DNA element, 5'-CTAATTGTTTA-3', of the gene PR2 promoter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q04996|HAT31_ARATH Homeobox protein HAT3.1 OS=Arabidopsis thaliana GN=HAT3.1 PE=2 SV=3 Back     alignment and function description
>sp|P46605|HOX1A_MAIZE Homeobox protein HOX1A OS=Zea mays GN=HOX1A PE=2 SV=1 Back     alignment and function description
>sp|P48786|PRH_PETCR Pathogenesis-related homeodomain protein OS=Petroselinum crispum GN=PRH PE=2 SV=1 Back     alignment and function description
>sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=PHF21A PE=1 SV=1 Back     alignment and function description
>sp|P87233|PHF1_SCHPO SWM histone demethylase complex subunit phf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phf1 PE=1 SV=1 Back     alignment and function description
>sp|Q09908|PHF2_SCHPO SWM histone demethylase complex subunit phf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phf2 PE=1 SV=1 Back     alignment and function description
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function description
>sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus GN=Phf21a PE=1 SV=2 Back     alignment and function description
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
225470662727 PREDICTED: pathogenesis-related homeodom 0.980 0.847 0.616 0.0
255573765 732 conserved hypothetical protein [Ricinus 0.947 0.812 0.607 0.0
224144330727 predicted protein [Populus trichocarpa] 0.920 0.795 0.633 0.0
224090517725 predicted protein [Populus trichocarpa] 0.904 0.783 0.618 0.0
449457269714 PREDICTED: pathogenesis-related homeodom 0.925 0.813 0.585 1e-167
356530336714 PREDICTED: pathogenesis-related homeodom 0.853 0.750 0.596 1e-160
356558320600 PREDICTED: pathogenesis-related homeodom 0.886 0.928 0.575 1e-160
449503000 741 PREDICTED: pathogenesis-related homeodom 0.855 0.724 0.560 1e-157
357449593707 Pathogenesis-related homeodomain protein 0.812 0.721 0.566 1e-150
356564821617 PREDICTED: pathogenesis-related homeodom 0.818 0.833 0.589 1e-149
>gi|225470662|ref|XP_002269263.1| PREDICTED: pathogenesis-related homeodomain protein [Vitis vinifera] gi|296090281|emb|CBI40100.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/637 (61%), Positives = 477/637 (74%), Gaps = 21/637 (3%)

Query: 1   MPGAGKKVVKHSESGKSCFPKKDSGSELIASLKFKKGSKISKSKKLRSKSRCQSKTVNST 60
           M G GKK   H ESGKSCFPK++ G +L A+L+ K GSKIS+++K + KS+  +KT+ + 
Sbjct: 1   MRGTGKKA-GHQESGKSCFPKRNIGPKLNAALQIKNGSKISQTRKCKPKSKSHAKTIGAI 59

Query: 61  LLKRTVAESHSKGAGDDFARSKSISQKNLHIKIDRKGSKNWASSKHKGKNSALVISKGNG 120
           L KRT   S SKG+       K I +K LH  ID + SK  +SSK KG+    + +  NG
Sbjct: 60  LSKRTTTGSPSKGSRSGSTTRKLIHKKTLHKAIDTESSKKESSSKLKGEKPPQISTNKNG 119

Query: 121 EVVDGDGETKKLRKGRSKKRRKEKVELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWK 180
           E VD + + +KL+K   +KRRK+  ELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWK
Sbjct: 120 ETVDKNVKPQKLKKRGKRKRRKDNSELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWK 179

Query: 181 GHSREKIRPEKELQRAKKQILKCKIGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHII 240
           GHSREKIRPEKELQRA KQILKCK+GIRDAIRQL+SLSS+GCIE + IA+DGSV+HEHII
Sbjct: 180 GHSREKIRPEKELQRATKQILKCKLGIRDAIRQLESLSSIGCIEDTAIASDGSVYHEHII 239

Query: 241 CAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTES----NQGWFCKFCECKMEIIE 296
           CAKCKLREAFPDNDI+LCDGTCNCAFHQKCLDPPL+TE+    +QGWFCKFCECKMEI+E
Sbjct: 240 CAKCKLREAFPDNDIILCDGTCNCAFHQKCLDPPLETENIPPGDQGWFCKFCECKMEILE 299

Query: 297 SMNAHIGTSFSVNSNWQDIFKEEAAFPDGCSALLNQEEEWPSDDSEDDDYNPERRENSCS 356
           +MNAH+GT FSV+S WQDIFKEEAA PDG SAL   EE+WPSDDS+D DY+PER ENSCS
Sbjct: 300 AMNAHLGTRFSVDSTWQDIFKEEAALPDGGSALPYPEEDWPSDDSQDHDYDPERNENSCS 359

Query: 357 ISRAGTD----DDPSSSTSLSWFSDSETFSESMRWEMESNGYKNYSVDSSIGSDETSDGE 412
           IS AGT+    DD +SS SLSW  + E  S S R           S   S  SDETSD E
Sbjct: 360 ISTAGTEGNASDDTNSSLSLSWSFEDEILSGSKR-----------SGIISADSDETSDCE 408

Query: 413 IICGRRQRRTVDYKKLYDEMFGKDASAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYG 472
           II GRRQRR VDY+KLYDEMFGKDA A EQ+SEDEDWGPA +RR+EKESDA ++L+TLY 
Sbjct: 409 IISGRRQRRAVDYRKLYDEMFGKDAHANEQVSEDEDWGPANKRRREKESDAASTLITLYE 468

Query: 473 SEEKYSKVKTAEVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKEL 532
            E+K   V+T E K+K+ S+ + +R F R+P +AVEKLRQ F ENELPSR V+ENL+K+L
Sbjct: 469 GEKKLPNVETMEAKQKISSDPQTKRPFSRIPLDAVEKLRQAFGENELPSRDVRENLAKQL 528

Query: 533 SLEPEKVNKWFKNARYLALKARKVESARQVSGSPRISKESSLETEK-KNADVLTLKNSLE 591
            L+ EKVNKWFKNARY+ALK RK E A+Q+  SPRISKES  E  K K  D++  +++  
Sbjct: 529 GLDYEKVNKWFKNARYIALKTRKAERAKQLQTSPRISKESRSEIVKDKTVDLVASRDNSS 588

Query: 592 ETLICSPKSLKKIHPKRIQNQSAVAAASRKISRKELL 628
            +L+ + K+LKK+  ++       +   +K  R+ LL
Sbjct: 589 ASLVRALKNLKKVRRRKNPKPIITSPVKKKHHRRALL 625

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255573765|ref|XP_002527803.1| conserved hypothetical protein [Ricinus communis] gi|223532799|gb|EEF34575.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224144330|ref|XP_002325264.1| predicted protein [Populus trichocarpa] gi|222866698|gb|EEF03829.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224090517|ref|XP_002309010.1| predicted protein [Populus trichocarpa] gi|222854986|gb|EEE92533.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449457269|ref|XP_004146371.1| PREDICTED: pathogenesis-related homeodomain protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356530336|ref|XP_003533738.1| PREDICTED: pathogenesis-related homeodomain protein-like [Glycine max] Back     alignment and taxonomy information
>gi|356558320|ref|XP_003547455.1| PREDICTED: pathogenesis-related homeodomain protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449503000|ref|XP_004161802.1| PREDICTED: pathogenesis-related homeodomain protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357449593|ref|XP_003595073.1| Pathogenesis-related homeodomain protein [Medicago truncatula] gi|355484121|gb|AES65324.1| Pathogenesis-related homeodomain protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356564821|ref|XP_003550646.1| PREDICTED: pathogenesis-related homeodomain protein-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
TAIR|locus:2005538 796 PRHA "pathogenesis related hom 0.713 0.562 0.530 3.5e-123
TAIR|locus:2090694723 HAT3.1 [Arabidopsis thaliana ( 0.280 0.243 0.494 1.1e-55
WB|WBGene00020485220 ceh-54 [Caenorhabditis elegans 0.167 0.477 0.288 0.00037
UNIPROTKB|H9KZW6725 H9KZW6 "Uncharacterized protei 0.081 0.070 0.425 0.00044
UNIPROTKB|I3LTW3113 I3LTW3 "Uncharacterized protei 0.065 0.362 0.409 0.00063
UNIPROTKB|H7C212228 MLL3 "Histone-lysine N-methylt 0.103 0.285 0.354 0.0007
TAIR|locus:2195945522 AT1G77250 "AT1G77250" [Arabido 0.101 0.122 0.371 0.00077
WB|WBGene00021913 679 cec-8 [Caenorhabditis elegans 0.342 0.316 0.25 0.00086
TAIR|locus:2005538 PRHA "pathogenesis related homeodomain protein A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1211 (431.4 bits), Expect = 3.5e-123, P = 3.5e-123
 Identities = 244/460 (53%), Positives = 317/460 (68%)

Query:   145 VELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREKIRPEKELQRAKKQILKCK 204
             VE+D++ RLQRRTRYLLIKMK++QNLIDAY+ EGWKG SREKIRP+KEL+RA+K+IL CK
Sbjct:    97 VEVDDSLRLQRRTRYLLIKMKMQQNLIDAYATEGWKGQSREKIRPDKELERARKEILNCK 156

Query:   205 IGIRDAIRQLDSLSSVGCIEGSVIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNC 264
             +G+RDAIRQLD LSSVG +E  VIA+DGS+HH+HI CA+C  REAFPDNDI+LCDGTCN 
Sbjct:   157 LGLRDAIRQLDLLSSVGSMEEKVIASDGSIHHDHIFCAECNSREAFPDNDIILCDGTCNR 216

Query:   265 AFHQKCLDPPLDTES----NQGWFCKFCECKMEIIESMNAHIGTSFSVNSNWQDIFKEEA 320
             AFHQKCLDPPL+TES    +QGWFCKFC+CK+EII++MNA IGT F V+SNWQDIF EEA
Sbjct:   217 AFHQKCLDPPLETESIPPGDQGWFCKFCDCKIEIIDTMNAQIGTHFPVDSNWQDIFNEEA 276

Query:   321 AFPDGCSALLNQXXXXXXXXXXXXXXXXXRRENSCSISRAGTXXXXXXXXXXXXXXXXET 380
             + P G  A +N                   REN    S   +                  
Sbjct:   277 SLPIGSEATVNNEADWPSDDSKDDDYDPEMRENGGGNSSNVSGDGGGDNDEESISTSLSL 336

Query:   381 FSESMRWEMESNGYKNYSVDSSIGSDETSDGEIICGRRQRRTVDYKKLYDEMFGKDASAF 440
              S+ +   + +  ++ + + + +   ETS+ E +CG RQRRTVDY +LY EMFGKDA   
Sbjct:   337 SSDGVA--LSTGSWEGHRLSNMVEQCETSNEETVCGPRQRRTVDYTQLYYEMFGKDAVLQ 394

Query:   441 EQLSEDEDWGPAKRRRKEKESDAVNSLMTLYGSEEK-YSKVKTAEVKKK---LPSNAKIR 496
             EQ SEDEDWGP  RR++++ESDA ++L+T+  S +K    V+T E  ++      N   R
Sbjct:   395 EQGSEDEDWGPNDRRKRKRESDAGSTLVTMCESSKKDQDVVETLEQSERDSVSVENKGGR 454

Query:   497 RSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARKV 556
             R   R+P NAVEKLRQVFAE ELPS+ V++ L+KELSL+PEKVNKWFKN RY+AL+ RK 
Sbjct:   455 RRMFRLPRNAVEKLRQVFAETELPSKAVRDRLAKELSLDPEKVNKWFKNTRYMALRNRKT 514

Query:   557 ESARQVSGSPRISK-ESSLETE-KKNADVLTLKNSLEETL 594
             ES +Q   S  +S  +S  E   + N +   ++++L++T+
Sbjct:   515 ESVKQPGDSKTVSGGDSGPEAVMENNTETNEVQDTLDDTV 554
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2090694 HAT3.1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00020485 ceh-54 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZW6 H9KZW6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTW3 I3LTW3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H7C212 MLL3 "Histone-lysine N-methyltransferase MLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2195945 AT1G77250 "AT1G77250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00021913 cec-8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00009253001
SubName- Full=Chromosome undetermined scaffold_226, whole genome shotgun sequence; (727 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
pfam0062851 pfam00628, PHD, PHD-finger 8e-11
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-08
smart0024947 smart00249, PHD, PHD zinc finger 2e-07
smart0038957 smart00389, HOX, Homeodomain 5e-07
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-04
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-04
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 57.1 bits (138), Expect = 8e-11
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 240 ICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQ--GWFCKFCECK 291
            CA C   +   D +++LCDG C+  FH  CL PPL+ E      W+C  C+ K
Sbjct: 1   YCAVC--GKVDDDGELLLCDG-CDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 628
KOG4299613 consensus PHD Zn-finger protein [General function 99.91
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.74
KOG0850245 consensus Transcription factor DLX and related pro 99.7
KOG1244336 consensus Predicted transcription factor Requiem/N 99.69
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.66
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.59
KOG0843197 consensus Transcription factor EMX1 and related HO 99.57
KOG0489261 consensus Transcription factor zerknullt and relat 99.52
KOG0488309 consensus Transcription factor BarH and related HO 99.49
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.48
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.48
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.46
KOG0493342 consensus Transcription factor Engrailed, contains 99.46
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.46
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.45
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.45
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.42
KOG0494332 consensus Transcription factor CHX10 and related H 99.41
KOG0848317 consensus Transcription factor Caudal, contains HO 99.31
COG5576156 Homeodomain-containing transcription factor [Trans 99.3
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.29
KOG0486 351 consensus Transcription factor PTX1, contains HOX 99.26
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.1
KOG0847288 consensus Transcription factor, contains HOX domai 99.09
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.05
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.04
KOG0490235 consensus Transcription factor, contains HOX domai 99.0
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.94
KOG0849354 consensus Transcription factor PRD and related pro 98.72
KOG0775304 consensus Transcription factor SIX and related HOX 98.71
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.65
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.62
KOG0774334 consensus Transcription factor PBX and related HOX 98.62
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.52
KOG2252558 consensus CCAAT displacement protein and related h 98.49
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.32
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.21
KOG1512381 consensus PHD Zn-finger protein [General function 98.21
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.16
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.06
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.06
KOG1973274 consensus Chromatin remodeling protein, contains P 98.04
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.02
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.97
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.93
KOG0954 893 consensus PHD finger protein [General function pre 97.9
COG5141669 PHD zinc finger-containing protein [General functi 97.84
KOG0383 696 consensus Predicted helicase [General function pre 97.75
KOG0490235 consensus Transcription factor, contains HOX domai 97.73
KOG0773342 consensus Transcription factor MEIS1 and related H 97.7
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.6
KOG0957707 consensus PHD finger protein [General function pre 97.55
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 97.24
KOG1146 1406 consensus Homeobox protein [General function predi 96.95
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.56
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.98
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 95.4
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 94.52
KOG0957 707 consensus PHD finger protein [General function pre 94.41
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 94.13
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 93.38
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 89.99
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.88
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 82.63
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.91  E-value=1.2e-24  Score=239.73  Aligned_cols=200  Identities=35%  Similarity=0.567  Sum_probs=169.8

Q ss_pred             cchhhHHHHHhhHHHHHHhhhhhhhhhhhhcCCCCcCCccc---------CCChHHHHHHHHHHHhhhhhHHHHHhhhhc
Q 006856          146 ELDEASRLQRRTRYLLIKMKLEQNLIDAYSGEGWKGHSREK---------IRPEKELQRAKKQILKCKIGIRDAIRQLDS  216 (628)
Q Consensus       146 ~~~~~~ri~~r~ry~l~~~~~Eq~l~~Ay~~egwkg~SreK---------~rP~kEl~rak~qi~k~K~~ird~l~~ld~  216 (628)
                      .+++.-|+..+++|+...+..+|.++++|+.+||++.+.+|         ++|.++..++..+|+.+++.++...+.++.
T Consensus       150 ~~p~~~r~~n~lk~~t~~~~~~~~li~~~s~e~~~a~~~~k~~~r~~~~~~~~~~~sn~tt~~i~~r~~~~~s~~~hl~t  229 (613)
T KOG4299|consen  150 EVPDSFRDKNSLKYLTSLQNDVQELIDISSTEGWKASSDEKPPGRPFELLIRPAKESNVTTKEILNRKLTYRSLPRHLET  229 (613)
T ss_pred             cCCCcchhhhhhhhhhccccccccccchhcccccccCCcccCcccchhhhcCcchhhccchhhhhhhhhhhhhhhhhhhh
Confidence            45678899999999999999999999999999999999999         999999999999999999999999999988


Q ss_pred             cCCCCCCCCCcccCCCCcccccc--ccccccccccCCCCCeeecCCccCccccccccCCC--CCCCCCCCcccccccchh
Q 006856          217 LSSVGCIEGSVIATDGSVHHEHI--ICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPP--LDTESNQGWFCKFCECKM  292 (628)
Q Consensus       217 l~~~~~i~~s~~~~dg~~~~e~~--~C~vC~~~~~~~~g~lllCDG~C~rayH~~CL~PP--L~~~P~g~W~Cp~C~~k~  292 (628)
                      ....+..++..+..++....+..  ||..|++.+..  ++|||||| |+++|||+||+||  ...+|.|.|||+.|.++.
T Consensus       230 ~s~~~t~~e~r~~~D~~~~~~~~~~fCsaCn~~~~F--~~~i~CD~-Cp~sFH~~CLePPl~~eniP~g~W~C~ec~~k~  306 (613)
T KOG4299|consen  230 ESKEGTVEEKRRERDKNISVEDIEDFCSACNGSGLF--NDIICCDG-CPRSFHQTCLEPPLEPENIPPGSWFCPECKIKS  306 (613)
T ss_pred             hhhhccchhhhhhhccccccCCHHHHHHHhCCcccc--ccceeecC-CchHHHHhhcCCCCCcccCCCCccccCCCeeee
Confidence            87777777777777777666665  99999998775  78899996 9999999999999  456789999999999998


Q ss_pred             hHHhhhh--------ccCCcccc--cCCc--cccccccccccCCCCccccCCCCCCCCCCCCCCCCCccc
Q 006856          293 EIIESMN--------AHIGTSFS--VNSN--WQDIFKEEAAFPDGCSALLNQEEEWPSDDSEDDDYNPER  350 (628)
Q Consensus       293 ~~~~~~n--------~~~gt~~~--l~~~--~~~vF~e~a~~~~g~~~~~n~e~~~psddseDed~dp~~  350 (628)
                      ..++..+        ..+++.|-  |+..  |+.+||+.+...-++..  +...+|++|+..+.+|+|..
T Consensus       307 ~in~~~~t~~~~~~~~~i~t~~~~~IDs~np~q~~lPe~i~~~~~~v~--~g~~~~~sd~~~~~pl~~~~  374 (613)
T KOG4299|consen  307 VINPKMETLSNRGTVVDIFTQFVSKIDSHNPIQKILPENISESFGGVS--RGDDGQYSDTQDEKPLDPPA  374 (613)
T ss_pred             ecccchhhhhhccchHHHHHHHHHhhhccchhhhhCCHHHHhhccccc--cCCCCccccccCCcCCChhh
Confidence            7666555        45555554  5555  89999997665555543  66889999999999999943

>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 1e-04
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 27/59 (45%), Gaps = 7/59 (11%)
Query: 232 GSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCEC 290
           GS HH    C  CK      D   +LC  TC  ++H  CL+PPL    N  W C  C C
Sbjct: 4   GSDHHMEF-CRVCK------DGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTC 55

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2yt5_A66 Metal-response element-binding transcription facto 5e-15
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 4e-14
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 4e-12
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-11
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 2e-11
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 3e-11
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 3e-11
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 5e-11
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 7e-11
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 2e-10
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 6e-10
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 2e-09
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-09
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 4e-09
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 4e-09
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 9e-09
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 2e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 5e-08
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 8e-08
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 1e-07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-05
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 5e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-06
2xsd_C164 POU domain, class 3, transcription factor 1; trans 5e-06
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 6e-06
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 4e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-05
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 8e-05
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 8e-05
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-04
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-04
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 2e-04
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-04
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-04
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 5e-04
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 6e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 7e-04
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 7e-04
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 79.9 bits (196), Expect = 1e-15
 Identities = 96/607 (15%), Positives = 176/607 (28%), Gaps = 189/607 (31%)

Query: 142 KEKVE--LDEASRLQRRTRYLLIKMKLEQ-NLIDAYSGE------GW---------KGHS 183
           KE+++  +     +   T  L   +  +Q  ++  +  E       +         +  S
Sbjct: 48  KEEIDHIIMSKDAVSG-TLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPS 106

Query: 184 REKIRPEKELQR--------AKKQI--LKCKIGIRDAIRQLDSLSSV------GCIEG-S 226
                  ++  R        AK  +  L+  + +R A+ +L    +V      G   G +
Sbjct: 107 MMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGS--GKT 164

Query: 227 VIATDGSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCA----------FHQKCLDPPLD 276
            +A D        +C   K++         L    CN             +Q  +DP   
Sbjct: 165 WVALD--------VCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQ--IDPNWT 214

Query: 277 TESNQGWFCKFCECKMEIIESMNAHIGTSFS-------------VNSNWQDIFKEEAAFP 323
           + S+          K+ I  S+ A +                  V +     +    AF 
Sbjct: 215 SRSDHS-----SNIKLRI-HSIQAELRRLLKSKPYENCLLVLLNVQNAK--AWN---AFN 263

Query: 324 DGCSALL-------------NQEEEWPSDDSEDDDYNPERRENSCSISRAGTDDDPSSST 370
             C  LL                     D         E +            D P    
Sbjct: 264 LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323

Query: 371 SLSWFSDSETFSESM-----RWEMESNGYKNYSVD-------SSIGSDETSDGEIICGRR 418
           + +    S   +ES+      W+     +K+ + D       SS+   E ++        
Sbjct: 324 TTNPRRLS-IIAESIRDGLATWD----NWKHVNCDKLTTIIESSLNVLEPAE-------- 370

Query: 419 QRRTVDYKKLYDEM--FGKDA----SAFEQLSEDEDWGPAKRRRKEKESDAVNSLMTLYG 472
                 Y+K++D +  F   A         +     W       K      VN L   Y 
Sbjct: 371 ------YRKMFDRLSVFPPSAHIPTILLSLI-----WFDVI---KSDVMVVVNKLHK-YS 415

Query: 473 SEEKYSKVKTA-------EVKKKLPSNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVK 525
             EK  K  T        E+K KL +      + HR   +     +   +++ +P  +  
Sbjct: 416 LVEKQPKESTISIPSIYLELKVKLEN----EYALHRSIVDHYNIPKTFDSDDLIPPYL-- 469

Query: 526 EN---------LSK-ELSLEPEKVNKWFKNARYLALKARKVESARQVSGS---------- 565
           +          L   E           F + R+L  K R   +A   SGS          
Sbjct: 470 DQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKF 529

Query: 566 --PRISKESSLETEKKNADVLTLKNSLEETLICSPKSLKKIHPKRIQ------NQSAVAA 617
             P I   +  + E+    +L     +EE LICS       +   ++      +++    
Sbjct: 530 YKPYICD-NDPKYERLVNAILDFLPKIEENLICSK------YTDLLRIALMAEDEAIFEE 582

Query: 618 ASRKISR 624
           A +++ R
Sbjct: 583 AHKQVQR 589
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.74
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.74
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.73
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.73
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.73
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.73
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.73
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.72
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.72
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.72
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.72
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.71
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.7
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.7
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.7
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.7
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.7
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.7
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.69
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.69
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.69
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.69
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.69
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.69
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.69
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.69
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.69
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.68
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.68
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.68
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.68
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.68
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.67
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.67
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.67
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.67
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.66
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.66
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.66
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.66
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.66
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.65
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.65
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.65
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.65
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.65
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.65
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.64
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.64
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.64
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.63
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.63
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.63
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.63
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.62
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.61
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.61
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.59
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.59
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.57
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.57
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.56
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.56
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.55
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.54
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.54
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.54
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.53
2e19_A64 Transcription factor 8; homeobox domain, structura 99.53
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.52
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.5
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.49
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.39
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.37
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.37
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.36
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.34
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.29
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.28
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.27
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.26
2yt5_A66 Metal-response element-binding transcription facto 99.26
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.26
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.25
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.24
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.24
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.24
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.24
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.21
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.2
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.19
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.16
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.12
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.12
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.12
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.11
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.1
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.04
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.03
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.97
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.84
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.76
1weu_A91 Inhibitor of growth family, member 4; structural g 98.61
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.6
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.55
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.54
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.53
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.53
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.46
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.44
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.26
1we9_A64 PHD finger family protein; structural genomics, PH 98.23
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.18
1wee_A72 PHD finger family protein; structural genomics, PH 98.14
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.11
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.05
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.91
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.9
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.88
1wem_A76 Death associated transcription factor 1; structura 97.83
1wew_A78 DNA-binding family protein; structural genomics, P 97.82
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.81
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.81
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.73
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.69
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.59
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.58
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.55
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.46
3kv5_D488 JMJC domain-containing histone demethylation prote 97.02
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 97.0
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.9
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 96.28
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 95.77
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 95.29
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 93.05
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.05
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 85.79
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 85.76
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 83.37
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 80.9
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 80.55
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=1.5e-18  Score=143.00  Aligned_cols=65  Identities=29%  Similarity=0.438  Sum_probs=59.4

Q ss_pred             CccccCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCcchhhhccchhccHHHHhhh
Q 006856          491 SNAKIRRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALKARK  555 (628)
Q Consensus       491 ~~~k~kR~r~rft~~Q~~~Le~~F~~~~yPs~~~r~~LA~~lgLt~~QVkiWFqNrR~k~~K~~~  555 (628)
                      ...+.+|.|++||.+|+.+||.+|..++||+..++++||..|||++.||++||||||++.+|...
T Consensus         3 ~~~~~rr~Rt~ft~~q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~rr~~~   67 (70)
T 2dmu_A            3 SGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGP   67 (70)
T ss_dssp             STTSSCCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHTST
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHccCCCCHHHHHHHHHHHCCCHHHeehccccccccccccCC
Confidence            34556888999999999999999999999999999999999999999999999999997776654
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 628
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 9e-11
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 4e-10
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-09
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 5e-09
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 5e-07
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 7e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-06
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-06
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 8e-06
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-04
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-04
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-04
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 3e-04
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-04
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-04
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 6e-04
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 8e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.001
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 0.001
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 0.001
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 0.002
d1q6za3183 c.36.1.9 (A:342-524) Benzoylformate decarboxylase 0.002
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 0.004
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.8 bits (134), Expect = 9e-11
 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 6/66 (9%)

Query: 232 GSVHHEHIICAKCKLREAFPDNDIVLCDGTCNCAFHQKCLDPPLDTESNQGWFCKFCECK 291
           G++     IC  C+        D+V+C+  C   FH  C  P L     + W C  C   
Sbjct: 1   GTLDDSATICRVCQK-----PGDLVMCNQ-CEFCFHLDCHLPALQDVPGEEWSCSLCHVL 54

Query: 292 MEIIES 297
            ++ E 
Sbjct: 55  PDLKEE 60
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 183 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.77
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.77
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.76
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.76
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.76
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.75
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.75
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.75
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.75
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.74
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.74
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.72
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.71
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.71
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.7
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.7
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.7
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.69
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.68
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.67
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.66
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.65
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.64
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.64
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.64
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.6
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.56
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.55
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.55
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.48
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.16
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.1
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.04
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.95
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.43
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.39
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.38
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.3
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.09
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.96
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.59
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 92.91
d1hlva166 DNA-binding domain of centromere binding protein B 88.2
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 86.69
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 86.0
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein prh
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=1.4e-19  Score=143.06  Aligned_cols=57  Identities=23%  Similarity=0.347  Sum_probs=53.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCcchhhhccchhccHHHH
Q 006856          496 RRSFHRMPPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARYLALK  552 (628)
Q Consensus       496 kR~r~rft~~Q~~~Le~~F~~~~yPs~~~r~~LA~~lgLt~~QVkiWFqNrR~k~~K  552 (628)
                      |++|++||+.|+.+||.+|..|+||+..++++||..|||++.||+|||||||++.+|
T Consensus         1 k~~R~~ft~~Q~~~Le~~F~~n~yp~~~~r~~LA~~l~L~~~qV~~WFqNrR~k~kk   57 (57)
T d2e1oa1           1 KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR   57 (57)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCHHHhhHhhhhhhhhccC
Confidence            567899999999999999999999999999999999999999999999999996654
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure