Citrus Sinensis ID: 006862

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MPEAPKNSYPSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSLLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKPNPKLADFIENECRKDCWQGIITRLWPNTKYVDVIVTGTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMAYFEFLPVHRNNGVANSISMPKSLNEKERQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAAVSEYTSYADTTTVPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWVAGHKQWSSNNNKATTRIEEMNGKAQTV
cccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHcccccccccHHHHHHHHHcccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHccccccEEccccccCEEEEEEccccccccccEEEEccccEEEEEccccccccccccccccccccccccccEEEccccccccEEEEEEEccccEEccccccEEEEcCECccccEEEEEEEcccEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccEEEEEEECccccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccHHHHHHHHHHHcccccccccccCECccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHccccccc
***********DYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLT********RKLMPTIEEELERRSLLYSLLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKPNPKLADFIENECRKDCWQGIITRLWPNTKYVDVIVTGTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMAYFEFLPVHRNNGVANSI*M*****EKERQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAAVSEYTSYADTTTVPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWVAGHKQ***************NG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEAPKNSYPSDYSLDEMNKKKLEFIENVTSNPDEVQKKVLSEILLRNAHVEYLQRNGLNGHTDRESFKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSLLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPLVVKDIRTGTIDSQITDPSVRDAVMKILKPNPKLADFIENECRKDCWQGIITRLWPNTKYVDVIVTGTMSQYIPILDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMAYFEFLPVHRNNGVANSISMPKSLNEKERQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAAVSEYTSYADTTTVPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWVAGHKQWSSNNNKATTRIEEMNGKAQTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Indole-3-acetic acid-amido synthetase GH3.6 Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin. Strongly reactive with Glu, Gln, Trp, Asp, Ala, Leu, Phe, Gly, Tyr, Met, Ile and Val. Little or no product formation with His, Ser, Thr, Arg, Lys, or Cys. Also active on pyruvic and butyric acid analogs of IAA, PAA and the synthetic auxin naphthaleneacetic acid (NAA). The two chlorinated synthetic auxin herbicides 2,4-D and 3,6-dichloro-o-anisic acid (dicamba) cannot be used as substrates.confidentQ9LSQ4
Probable indole-3-acetic acid-amido synthetase GH3.1 May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableQ8LQM5
Probable indole-3-acetic acid-amido synthetase GH3.8 May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.probableA3BLS0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B2G, chain A
Confidence level:very confident
Coverage over the Query: 16-554,571-605
View the alignment between query and template
View the model in PyMOL