Citrus Sinensis ID: 006883


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------
MASNLKVDQLRAKLAQRGLSTAGTKAILVQRLEEAVEEENKKSVGSKKRGRECDETDSNGSQKVKSIESFGQMGVKQLREQADLRGLSKAGTKKELLERLCNHAEQSDSKDTLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSANQKEESVVHEKPNSTINIQPRNTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKQFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK
ccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHccccccccccccccccccEEEEccccEEEEEEEEEEcccccccEEEEEEEECcccccEEEEEEECccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccHHcccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHccccEEEcccccHHHHHHHHHHHcccccccccccccEEEEEEEEcccHHHHHHHHcccccccEEEEcccccccHHHHHccccccccccccccccccCEEEEEccccccccccccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEccccEEEccccccccccccccccccEEEEEEcccEEEEEEEEEEEEEc
****LKV**LRAKLAQ*GLSTAGTKAILVQRL******************************************************************************DTLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSAN********************NTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKQFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNLKVDQLRAKLAQRGLSTAGTKAILxxxxxxxxxxxxxxxxxxxxxGRECDETDSNGSQKVKSIESFGQMGVKQLREQADLRGLSKAGTKKELLERLCNHAEQSDSKDTLLQEEVNECKDEKIVKATKKGAAVLDPWLPEHIKISYHVFQKDNDIYDAMLNQTNVGDNNNKFYVIQLLESDGGGEYMVYNRWGRVGMKGQDKIFGPYNLQDTAINEFEQKFFAKTKNHWSNRRQFTSYPKCYTWLEMDYSANQKEESVVHEKPNSTINIQPRNTKLEPCVAKFISLICNISMMKQLMMEIGYNANKLPLGKLSKSTILKGYDVLKRIADVIHPPDRRKLEELSGEFYTVIPHDFGFKKMRDFVIDTPQKLKLKLEMVEALGEIEVATKLLEDDTEIQADPLYSHYQRLHCQLTPLEVDSLEFSLIANYLLNTHAKTHSAYSVDIVQIFRVEREGETERFRKQFSNSKNRMLLWHGSRLTNWTGILSQGLRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASPSATAGVLLLCEVALGDMSELLYANYDADKLPDGKLSTKGVGQTAPDPLEAETLEDGVIVPLGKPKEQLNSKGHLLYNEYIVYSVDQIRMRYVVQVNFKYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Poly [ADP-ribose] polymerase 2-A Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.probableQ5Z8Q9
Poly [ADP-ribose] polymerase 2 Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.probableQ11207
Poly [ADP-ribose] polymerase 2 Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.probableO50017

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.2.-Pentosyltransferases.probable
2.4.2.30NAD(+) ADP-ribosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQY, chain C
Confidence level:very confident
Coverage over the Query: 135-251,276-614
View the alignment between query and template
View the model in PyMOL
Template: 1JJR, chain A
Confidence level:confident
Coverage over the Query: 39-40,52-105
View the alignment between query and template
View the model in PyMOL