Citrus Sinensis ID: 006913

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620------
MQDIGFDSFHSYRSCFPFLTFASFSSSAKVPYRRSAFRLSKPLIGEDGKIYACSEKTLFAFESNGTIAWSLDLDFTCNIGTAPVHGGTGEVYIVAENRVLKVDLLKIGTSESATQVFYGTGSGKGGTGAIAGIAVSTSSSSVYINVKGRALFAFMTHGQLLWSAGPVLDQLGYRQGCTKTDVDCYFTSVPVIDQCEGSIYISNTQGELYSLSAHSPYFNWIQDLSSFDKAFTLTPGNNGYLYVTIPVRALVLALDTSSGNILWHKSVGPLGSAEYAPVVDSNGWISVGSLDGLLYSFSPSGVLNKFSKSDTSDSVIQSSPYWFHLLGPSIGLKAILCLMVVGQFSSLLSKSDLQHFVLDESLVLAFLTASNQKLVASCSQTRPKLPSIYTGNERAILLFLFFESVVLLVLAVLVRFCCIFWRKKKLQGQHLGNFLEKRRSLQLKKKAFDRSITELEKKVAEDAVANEVIKKSVVCLGRDEAAASSESKSFPPVYDAKSRSYSFQGAKKESVTIFHTLSATSSAESSSERETSWVSEDKDQSTAKAKAKAKAKAPIKAESSSDGDGIMDKEYRRSPSEPASSSRGFINPLLLKQEKLQDKGEVVESMSSSIRSMLLLKRRRTLSSTN
ccccccccccccccccEEEEEEEccccccCEEECcccEEcccEECcccEEEEEcccEEEEEcccccEEEEEEcccccCEECccCECcccEEEEEEcccEEEEEEEcccccccCEEEEEcccccccccccEEEEEEEEcccEEEEEEcccEEEEEEccccEEEECcccccccccccccCCcccccEECcccCECccccEEEEEccccEEEEEEccccEEEEEEEcccccccCEEEECcccEEEEEEccccEEEEEEcccccEEEEEEccccccCEEEEEECcccEEEEEccccEEEEEcccccCEEEECccccccEEEEcccEEEEcCEEEEccEEEEEEEccEEEEEEEcccccEEEEcccEEEEEEEcccccEEEEEcccccccccCCccccEEEEEEEEccccHHHHHHHHEEEEEEEEEEHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHEEccEEEEcccccccccccccccccccccccEEEcccccCEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHcccccccEEEEEEcccccccc
****GFDSFHSYRSCFPFLTFASFSSSAKVPYRRSAFRLSKPLIGEDGKIYACSEKTLFAFESNGTIAWSLDLDFTCNIGTAPVHGGTGEVYIVAENRVLKVDLLKIGTSESATQVFYGTGSGKGGTGAIAGIAVSTSSSSVYINVKGRALFAFMTHGQLLWSAGPVLDQLGYRQGCTKTDVDCYFTSVPVIDQCEGSIYISNTQGELYSLSAHSPYFNWIQDLSSFDKAFTLTPGNNGYLYVTIPVRALVLALDTSSGNILWHKSVGPLGSAEYAPVVDSNGWISVGSLDGLLYSFSPSGVLNKFSKSDTSDSVIQSSPYWFHLLGPSIGLKAILCLMVVGQFSSLLSKSDLQHFVLDESLVLAFLTASNQKLVASCSQTRPKLPSIYTGNERAILLFLFFESVVLLVLAVLVRFCCIFWRKKKLQGQHLGNFLEKRRSLQLKKKAFDRSITELEKKVAEDAVANEVIKKSVVCLG***************VYD****************TI****************************************************************************L***********************LLL***RT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDIGFDSFHSYRSCFPFLTFASFSSSAKVPYRRSAFRLSKPLIGEDGKIYACSEKTLFAFESNGTIAWSLDLDFTCNIGTAPVHGGTGEVYIVAENRVLKVDLLKIGTSESATQVFYGTGSGKGGTGAIAGIAVSTSSSSVYINVKGRALFAFMTHGQLLWSAGPVLDQLGYRQGCTKTDVDCYFTSVPVIDQCEGSIYISNTQGELYSLSAHSPYFNWIQDLSSFDKAFTLTPGNNGYLYVTIPVRALVLALDTSSGNILWHKSVGPLGSAEYAPVVDSNGWISVGSLDGLLYSFSPSGVLNKFSKSDTSDSVIQSSPYWFHLLGPSIGLKAILCLMVVGQFSSLLSKSDLQHFVLDESLVLAFLTASNQKLVASCSQTRPKLPSIYTGNERAILLFLFFESVVLLVLAVLVRFCCIFWRKKKLQGQHLGNFLEKxxxxxxxxxxxxxxxxxxxxxVAEDAVANEVIKKSVVCLGRDEAAASSESKSFPPVYDAKSRSYSFQGAKKESVTIFHTLSATSSAESSSERETSWVSEDKDQSTAKAKAKAKAKAPIKAESSSDGDGIMDKEYRRSPSEPASSSRGFINPLLLKQEKLQDKGEVVESMSSSIRSMLLLKRRRTLSSTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein GAMETE EXPRESSED 3 Required for micropylar pollen tube guidance. Plays a role during early embryo patterning.probableQ9LFS2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HXJ, chain A
Confidence level:very confident
Coverage over the Query: 36-172,184-347
View the alignment between query and template
View the model in PyMOL
Template: 3HXJ, chain A
Confidence level:very confident
Coverage over the Query: 35-120,132-172,184-380
View the alignment between query and template
View the model in PyMOL
Template: 3Q7M, chain A
Confidence level:very confident
Coverage over the Query: 37-180,192-345
View the alignment between query and template
View the model in PyMOL
Template: 2XBG, chain A
Confidence level:probable
Coverage over the Query: 21-302
View the alignment between query and template
View the model in PyMOL