Citrus Sinensis ID: 006947


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----
MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
cccccccccccccccccccHHHHccccccHccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccccHHHHHHHHHHccccccccccccccccHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHcHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHcccccHHHccccccc
*****************HISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRV****************************************VSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENA***DPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLY****************************************************************************************************************************************************************************************************HPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 30 probableP93755
Zinc finger CCCH domain-containing protein 24 probableQ10EL1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 32-215
View the alignment between query and template
View the model in PyMOL
Template: 1SW6, chain A
Confidence level:very confident
Coverage over the Query: 26-215
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:confident
Coverage over the Query: 299-331
View the alignment between query and template
View the model in PyMOL
Template: 2LHN, chain A
Confidence level:confident
Coverage over the Query: 269-289,303-326,338-360
View the alignment between query and template
View the model in PyMOL