Citrus Sinensis ID: 006947

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----
MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
ccccccccccccccccccHHHHHHccccHHHcccccccccccHHHHHHHHcccHHHHHHHHHHcccccccHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccccccccccHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHcHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHcccccHHHccccccc
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHccccccccccEccccccccccccccccHHHHHHHHcHHHHHHHHHcccccccccccccccccHHHHHHccccHHHHHHHHHHHHccccccccccccccccEEEEEccccHHHHHHHHHHHcccccccccccEccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccHcccccccccccccccccccccccccccccHHHcccEHEcccHHHHcccccccccccccEEEEEEcccHHcccccccccccccccccccccHHHccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHcccccccccccHcccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHcHHHHHHHHcHHHHHHHccccc
mccgperlnrtpsprsphisfdesrhtnvdmnhltvETDDAFASLLELAAnndvegfkrsivcdpsgvdevglwygrqkgskqmvneQRTPLMVAATYGSIDIIRLILSesgadvnlscgndkstaLHCAASGGALNAVDVVKLLLAagadpnfvdakghhpvdvivvppkfqDVRLTLEELLAtdgsvernlrvstttsnsnspplspalengsptsasgspmksmsvdapsfsvsekkeypidpslpdiknsiystdefrmysfkvrpcsrayshdwtecpfvhpgenarrrdprkfhyscvpcpdfrkgacrrgdmceyahgvfecwlhpaQYRTRLCkdgtscarrvcffahtpeelrplyvstgsavpsprsstsgaTAMDFAAALsllpgspssvnvmspspftppmspsangishsnvawpqpnvpalhlpgsnlqssrlrsslnardmpvddfnmlpdfDVQQQQLLNElstlsqptlssslnrsgrmktltpsnlddlfsaessspryADQALAaavfspthkSAVLNQFQQQQQQsmlspintnfspknvdhpllqaslgchhhqggcppemwnlyhqwapgYLYWLNVrssnnfaasalgnlapillpllvpr
mccgperlnrtpsprsphisfdesrhtnVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGrqkgskqmvneQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELlatdgsvernlrvstttsnsnspplspALENGSPTSASGSPMKSMSVDAPSFSVSEKkeypidpslpdiknsiysTDEFRMYSFKVRPCSRAYSHDWTECPfvhpgenarrrdprKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFahtpeelrplyVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELStlsqptlssslnrsgrmktLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASalgnlapillpllvpr
MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERnlrvstttsnsnspplspalENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFaaalsllpgspssvnvmspspftppmspsANGISHSNVAWPQPNVPALHLPGsnlqssrlrsslnARDMPVDDFNMLPDFDVQQQQLLNElstlsqptlssslNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNqfqqqqqqSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASAlgnlapillpllvpR
********************************HLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKG***MVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLAT******************************************************************KNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENA***DPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYV***************************************************************************************************************************************************************************************************HPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLV**
**CGPE*******PRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHP********PRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPE*********************************************************************************************************************************************************************************************************************************LYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
*****************HISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRV****************************************VSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVS*************GATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
********************************HLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATD******************************************************EYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLY*S*************************************************************QPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTL*******************PSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTNFSPKNVDHPLLQASLGCHHHQGGCPPEMWNLYHQWAPGYLYWLNVRSSNNFAASALGNLAPILLPLLVPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query624 2.2.26 [Sep-21-2011]
P93755 716 Zinc finger CCCH domain-c yes no 0.862 0.751 0.731 0.0
Q9LXV4706 Zinc finger CCCH domain-c no no 0.826 0.730 0.604 1e-179
Q10EL1 764 Zinc finger CCCH domain-c yes no 0.833 0.680 0.639 1e-173
Q2QPW2619 Zinc finger CCCH domain-c no no 0.703 0.709 0.493 1e-118
Q84SL2657 Zinc finger CCCH domain-c no no 0.743 0.706 0.488 1e-116
Q9LUZ4607 Zinc finger CCCH domain-c no no 0.692 0.711 0.480 1e-116
Q9XEE6597 Zinc finger CCCH domain-c no no 0.657 0.686 0.452 1e-105
Q93ZS9580 Zinc finger CCCH domain-c no no 0.573 0.617 0.474 1e-100
Q688R3601 Zinc finger CCCH domain-c no no 0.565 0.587 0.426 1e-73
Q9FU27386 Zinc finger CCCH domain-c no no 0.169 0.274 0.792 1e-51
>sp|P93755|C3H30_ARATH Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana GN=At2g41900 PE=1 SV=2 Back     alignment and function desciption
 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/577 (73%), Positives = 469/577 (81%), Gaps = 39/577 (6%)

Query: 1   MCCGPERLNRTPSPRSPH-ISFDESRH--TNVDMNHLTVETDDAFASLLELAANNDVEGF 57
           MCCG +RLN+  S RS   ISF+E  +  TN DMNHLTVET+D FASLLELAANNDVEG 
Sbjct: 1   MCCGSDRLNQIVSSRSSLPISFEEDNNLVTNTDMNHLTVETEDTFASLLELAANNDVEGV 60

Query: 58  KRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNL 117
           + SI  DPS VDE GLWYGRQKGSK MVN+ RTPLMVAATYGSID+I+LI+S + ADVN 
Sbjct: 61  RLSIERDPSCVDEAGLWYGRQKGSKAMVNDYRTPLMVAATYGSIDVIKLIVSLTDADVNR 120

Query: 118 SCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRL 177
           +CGND++TALHCAASGGA+NA+ VVKLLLAAGAD N +DA+G    DVIVVPPK + V+L
Sbjct: 121 ACGNDQTTALHCAASGGAVNAIQVVKLLLAAGADLNLLDAEGQRAGDVIVVPPKLEGVKL 180

Query: 178 TLEELLATDGS--VERNLRVSTTTSN-SNSPPLSPALENGSPTSASGSPMKSMSVDAPSF 234
            L+ELL+ DGS   ERNLRV T   N S+SP  SP  ENG   S S        + +  F
Sbjct: 181 MLQELLSADGSSTAERNLRVVTNVPNRSSSPCHSPTGENGGSGSGSPL-GSPFKLKSTEF 239

Query: 235 SVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRR 294
               KKEYP+DPSLPDIKNSIY+TDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRR
Sbjct: 240 ----KKEYPVDPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRR 295

Query: 295 DPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFF 354
           DPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGT CARRVCFF
Sbjct: 296 DPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTGCARRVCFF 355

Query: 355 AHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMS 414
           AHTPEELRPLY STGSAVPSPRS+       D+AAALSLLPGSPS V+VMS      P+S
Sbjct: 356 AHTPEELRPLYASTGSAVPSPRSNA------DYAAALSLLPGSPSGVSVMS------PLS 403

Query: 415 PSA--NGISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQ 472
           PSA  NG+SHSN+AWPQPNVPALHLPGSNLQSSRLRSSLNARD+P D+FNML D+  +QQ
Sbjct: 404 PSAAGNGMSHSNMAWPQPNVPALHLPGSNLQSSRLRSSLNARDIPTDEFNMLADY--EQQ 461

Query: 473 QLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAE-SSSPRYADQALAAAVFSPTH 531
           QLLNE         S++L+RSGRMK++ PSNL+DLFSAE SSSPR+ D ALA+AVFSPTH
Sbjct: 462 QLLNE--------YSNALSRSGRMKSMPPSNLEDLFSAEGSSSPRFTDSALASAVFSPTH 513

Query: 532 KSAVLN--QFQQQQQQSMLSPINTNF-SPKNVDHPLL 565
           KSAV N  Q QQQQQQSMLSPINT+F SPK+VDH L 
Sbjct: 514 KSAVFNQFQQQQQQQQSMLSPINTSFSSPKSVDHSLF 550

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LXV4|C3H56_ARATH Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana GN=At5g12850 PE=2 SV=1 Back     alignment and function description
>sp|Q10EL1|C3H24_ORYSJ Zinc finger CCCH domain-containing protein 24 OS=Oryza sativa subsp. japonica GN=Os03g0698800 PE=2 SV=1 Back     alignment and function description
>sp|Q2QPW2|C3H67_ORYSJ Zinc finger CCCH domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=Os12g0515500 PE=2 SV=1 Back     alignment and function description
>sp|Q84SL2|C3H50_ORYSJ Zinc finger CCCH domain-containing protein 50 OS=Oryza sativa subsp. japonica GN=Os07g0568300 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUZ4|C3H66_ARATH Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana GN=At5g58620 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEE6|C3H29_ARATH Zinc finger CCCH domain-containing protein 29 OS=Arabidopsis thaliana GN=At2g40140 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZS9|C3H47_ARATH Zinc finger CCCH domain-containing protein 47 OS=Arabidopsis thaliana GN=At3g55980 PE=2 SV=1 Back     alignment and function description
>sp|Q688R3|C3H33_ORYSJ Zinc finger CCCH domain-containing protein 33 OS=Oryza sativa subsp. japonica GN=Os05g0128200 PE=2 SV=1 Back     alignment and function description
>sp|Q9FU27|C3H2_ORYSJ Zinc finger CCCH domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=Os01g0192000 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query624
255571544 728 nucleic acid binding protein, putative [ 0.908 0.778 0.846 0.0
224087035 735 predicted protein [Populus trichocarpa] 0.905 0.768 0.813 0.0
224139860 732 predicted protein [Populus trichocarpa] 0.908 0.774 0.804 0.0
255571542 725 nucleic acid binding protein, putative [ 0.907 0.780 0.832 0.0
302398727 731 C3HL domain class transcription factor [ 0.908 0.775 0.808 0.0
302398721 736 C3HL domain class transcription factor [ 0.908 0.770 0.787 0.0
449437627701 PREDICTED: zinc finger CCCH domain-conta 0.862 0.767 0.780 0.0
359481761703 PREDICTED: zinc finger CCCH domain-conta 0.862 0.765 0.809 0.0
357509737 734 Zinc finger CCCH domain-containing prote 0.902 0.767 0.759 0.0
356533223 819 PREDICTED: zinc finger CCCH domain-conta 0.894 0.681 0.764 0.0
>gi|255571544|ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533907|gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/572 (84%), Positives = 518/572 (90%), Gaps = 5/572 (0%)

Query: 1   MCCGPERLNRTPSPRSPHISFDESRHTNVDMNHLTVETDDAFASLLELAANNDVEGFKRS 60
           MCCG ERL  TP P    IS ++SR TN+DMNHLTVET+D FASLLELAANND+EGFKR+
Sbjct: 1   MCCGLERLKPTPFPTLLLISSEDSRSTNIDMNHLTVETEDTFASLLELAANNDIEGFKRT 60

Query: 61  IVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCG 120
           I  DPS VDE+GLWYGR+KGSKQMVNE RTPLMVAATYGSID+I+LILS S ADVN SCG
Sbjct: 61  IERDPSCVDEIGLWYGRRKGSKQMVNEHRTPLMVAATYGSIDVIKLILSSSDADVNRSCG 120

Query: 121 NDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLE 180
            DKSTALHC ASGGA+NAVDVVKLLLAAGADPN +DA GH P+DVIVVPPK   V+  LE
Sbjct: 121 LDKSTALHCVASGGAVNAVDVVKLLLAAGADPNSIDANGHRPIDVIVVPPKLDGVKFALE 180

Query: 181 ELLATDGSV-ERNLRVSTTTSNSNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEK 239
           ELL  DGSV ER+LRVST TSNS SPPLSP++ NGSP S+S SP+KS   DA   + SEK
Sbjct: 181 ELLVNDGSVIERDLRVSTATSNSTSPPLSPSVGNGSPLSSSDSPVKSKLHDATISTASEK 240

Query: 240 KEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKF 299
           KEYP+DPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKF
Sbjct: 241 KEYPVDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKF 300

Query: 300 HYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPE 359
           HYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHT E
Sbjct: 301 HYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTVE 360

Query: 360 ELRPLYVSTGSAVPSPRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANG 419
           ELRPLYVSTGSAVPSPRSSTSGATAMDFAAA+SLLPGSPSSV+VMSP+PFTPPMSPSAN 
Sbjct: 361 ELRPLYVSTGSAVPSPRSSTSGATAMDFAAAMSLLPGSPSSVSVMSPTPFTPPMSPSANS 420

Query: 420 ISHSNVAWPQPNVPALHLPGSNLQSSRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELS 479
           +SHS+VAWPQPNVPALHLPGSNLQSSRLRSSLNARD+  DD++MLPDFDVQQQQLLNELS
Sbjct: 421 MSHSSVAWPQPNVPALHLPGSNLQSSRLRSSLNARDIQADDYSMLPDFDVQQQQLLNELS 480

Query: 480 TLSQPTLS-SSLNRSGRMKTLTPSNLDDLFSAESSSPRYADQALAAAVFSPTHKSAVLNQ 538
           +L+QP LS +SLNRSGR+K LTPSNLDDLFSAESSSPRYADQALA+AVFSPTHKSAVLNQ
Sbjct: 481 SLTQPALSNNSLNRSGRLK-LTPSNLDDLFSAESSSPRYADQALASAVFSPTHKSAVLNQ 539

Query: 539 FQQQQQQSMLSPINTNFSPKNVDHPLLQASLG 570
           F  QQQQSMLSPINTNFSPKNVDHPLLQAS  
Sbjct: 540 F--QQQQSMLSPINTNFSPKNVDHPLLQASFA 569

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224087035|ref|XP_002308038.1| predicted protein [Populus trichocarpa] gi|222854014|gb|EEE91561.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139860|ref|XP_002323312.1| predicted protein [Populus trichocarpa] gi|222867942|gb|EEF05073.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255571542|ref|XP_002526717.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533906|gb|EEF35631.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302398727|gb|ADL36658.1| C3HL domain class transcription factor [Malus x domestica] gi|302398729|gb|ADL36659.1| C3HL domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398721|gb|ADL36655.1| C3HL domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|449437627|ref|XP_004136593.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Cucumis sativus] gi|449516906|ref|XP_004165487.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 1 [Cucumis sativus] gi|449516908|ref|XP_004165488.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359481761|ref|XP_002277747.2| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357509737|ref|XP_003625157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|124360202|gb|ABN08215.1| Zinc finger, CCCH-type [Medicago truncatula] gi|355500172|gb|AES81375.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356533223|ref|XP_003535166.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query624
TAIR|locus:2064647 716 OXS2 "OXIDATIVE STRESS 2" [Ara 0.735 0.641 0.661 6.9e-206
TAIR|locus:2182250706 AT5G12850 [Arabidopsis thalian 0.852 0.753 0.530 1e-148
TAIR|locus:2178843607 AT5G58620 [Arabidopsis thalian 0.349 0.359 0.608 1.5e-104
TAIR|locus:2065058597 CZF1 [Arabidopsis thaliana (ta 0.221 0.231 0.782 1.5e-98
TAIR|locus:2082068580 SZF1 "salt-inducible zinc fing 0.221 0.237 0.762 3.8e-91
UNIPROTKB|Q9FU27386 LOC_Os01g09620 "Zinc finger CC 0.205 0.331 0.689 2.8e-50
TAIR|locus:2052005359 OZF1 "Oxidation-related Zinc F 0.238 0.415 0.588 3.2e-49
TAIR|locus:2043565315 ATCTH [Arabidopsis thaliana (t 0.189 0.374 0.708 2.3e-48
TAIR|locus:2118209356 OZF2 "oxidation-related zinc f 0.217 0.382 0.620 2.9e-48
TAIR|locus:2024112393 SOM "SOMNUS" [Arabidopsis thal 0.214 0.340 0.605 1.6e-47
TAIR|locus:2064647 OXS2 "OXIDATIVE STRESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1604 (569.7 bits), Expect = 6.9e-206, Sum P(2) = 6.9e-206
 Identities = 320/484 (66%), Positives = 355/484 (73%)

Query:     1 MCCGPERLNRTPSPRSP-HISFDESRH--TNVDMNHLTVETDDAFASLLELAANNDVEGF 57
             MCCG +RLN+  S RS   ISF+E  +  TN DMNHLTVET+D FASLLELAANNDVEG 
Sbjct:     1 MCCGSDRLNQIVSSRSSLPISFEEDNNLVTNTDMNHLTVETEDTFASLLELAANNDVEGV 60

Query:    58 KRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNL 117
             + SI  DPS VDE GLWYGRQKGSK MVN+ RTPLMVAATYGSID+I+LI+S + ADVN 
Sbjct:    61 RLSIERDPSCVDEAGLWYGRQKGSKAMVNDYRTPLMVAATYGSIDVIKLIVSLTDADVNR 120

Query:   118 SCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRL 177
             +CGND++TALHCAASGGA+NA+ VVKLLLAAGAD N +DA+G    DVIVVPPK + V+L
Sbjct:   121 ACGNDQTTALHCAASGGAVNAIQVVKLLLAAGADLNLLDAEGQRAGDVIVVPPKLEGVKL 180

Query:   178 TLEELLATDGS--VERXXXXXXXXXXXXXXXXXX-XXENGSPTSASGSPMKS-MSVDAPS 233
              L+ELL+ DGS   ER                     ENG   S SGSP+ S   + +  
Sbjct:   181 MLQELLSADGSSTAERNLRVVTNVPNRSSSPCHSPTGENGG--SGSGSPLGSPFKLKSTE 238

Query:   234 FSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARR 293
             F    KKEYP+DPSLPDIKNSIY+TDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARR
Sbjct:   239 F----KKEYPVDPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARR 294

Query:   294 RDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCF 353
             RDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGT CARRVCF
Sbjct:   295 RDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTGCARRVCF 354

Query:   354 FAHTPEELRPLYVSTGSAVPSPRSSTSGATAMDFXXXXXXXXXXXXXXXXXXXXXXXXXX 413
             FAHTPEELRPLY STGSAVPSPRS+   A A+                            
Sbjct:   355 FAHTPEELRPLYASTGSAVPSPRSNADYAAALSLLPGSPSGVSVMSPLSPSAA------- 407

Query:   414 XXXANGISHSNVAWPQPNVPALHLPGXXXXXXXXXXXXXARDMPVDDFNMLPDFDVQQQQ 473
                 NG+SHSN+AWPQPNVPALHLPG             ARD+P D+FNML D++  QQQ
Sbjct:   408 ---GNGMSHSNMAWPQPNVPALHLPGSNLQSSRLRSSLNARDIPTDEFNMLADYE--QQQ 462

Query:   474 LLNE 477
             LLNE
Sbjct:   463 LLNE 466
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
TAIR|locus:2182250 AT5G12850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178843 AT5G58620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065058 CZF1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082068 SZF1 "salt-inducible zinc finger 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FU27 LOC_Os01g09620 "Zinc finger CCCH domain-containing protein 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2052005 OZF1 "Oxidation-related Zinc Finger 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043565 ATCTH [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118209 OZF2 "oxidation-related zinc finger 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024112 SOM "SOMNUS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10EL1C3H24_ORYSJNo assigned EC number0.63980.83330.6806yesno
P93755C3H30_ARATHNo assigned EC number0.73130.86210.7513yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query624
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-08
smart0035627 smart00356, ZnF_C3H1, zinc finger 1e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-04
smart0024830 smart00248, ANK, ankyrin repeats 7e-04
smart0024830 smart00248, ANK, ankyrin repeats 8e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 8e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.004
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information 
 Score = 74.2 bits (183), Expect = 2e-16
 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 78  QKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALN 137
           +KG+   + +  T L +AA  G+++I++L+L E GADVN    +   TALH AA  G L 
Sbjct: 18  EKGADVNLGDTDTALHLAARNGNLEIVKLLL-EHGADVNAKDKDGN-TALHLAARNGNL- 74

Query: 138 AVDVVKLLLAAGADPNFVD 156
             ++VKLLL  GAD N  D
Sbjct: 75  --EIVKLLLEHGADINLKD 91

Length = 91
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 624
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.94
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.91
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.88
PHA02791284 ankyrin-like protein; Provisional 99.87
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.87
PHA02878477 ankyrin repeat protein; Provisional 99.86
PHA02946446 ankyin-like protein; Provisional 99.85
PHA02874434 ankyrin repeat protein; Provisional 99.85
PHA02875413 ankyrin repeat protein; Provisional 99.85
PHA02874434 ankyrin repeat protein; Provisional 99.85
PHA02875413 ankyrin repeat protein; Provisional 99.85
PHA02878477 ankyrin repeat protein; Provisional 99.84
PHA02859209 ankyrin repeat protein; Provisional 99.83
PHA02791284 ankyrin-like protein; Provisional 99.83
PHA03095471 ankyrin-like protein; Provisional 99.83
PHA03100480 ankyrin repeat protein; Provisional 99.83
KOG0508615 consensus Ankyrin repeat protein [General function 99.83
PHA03095471 ankyrin-like protein; Provisional 99.82
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.82
PHA02798489 ankyrin-like protein; Provisional 99.82
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.82
PHA02989494 ankyrin repeat protein; Provisional 99.81
PHA02876682 ankyrin repeat protein; Provisional 99.81
PHA02946446 ankyin-like protein; Provisional 99.81
PHA03100480 ankyrin repeat protein; Provisional 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02876682 ankyrin repeat protein; Provisional 99.81
PHA02741169 hypothetical protein; Provisional 99.81
KOG0508615 consensus Ankyrin repeat protein [General function 99.8
PHA02989494 ankyrin repeat protein; Provisional 99.8
PHA02798489 ankyrin-like protein; Provisional 99.8
PHA02795437 ankyrin-like protein; Provisional 99.8
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.79
KOG0514452 consensus Ankyrin repeat protein [General function 99.79
KOG0510 929 consensus Ankyrin repeat protein [General function 99.79
PHA02917661 ankyrin-like protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.78
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.77
PLN03192823 Voltage-dependent potassium channel; Provisional 99.77
KOG0510929 consensus Ankyrin repeat protein [General function 99.76
PLN03192823 Voltage-dependent potassium channel; Provisional 99.76
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.75
PHA02884300 ankyrin repeat protein; Provisional 99.74
PHA02795437 ankyrin-like protein; Provisional 99.73
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.71
TIGR00870743 trp transient-receptor-potential calcium channel p 99.71
PHA02917661 ankyrin-like protein; Provisional 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.7
PHA02741169 hypothetical protein; Provisional 99.69
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.68
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.68
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
PHA02743166 Viral ankyrin protein; Provisional 99.66
PHA02730672 ankyrin-like protein; Provisional 99.65
KOG0514452 consensus Ankyrin repeat protein [General function 99.65
PHA02730672 ankyrin-like protein; Provisional 99.64
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.64
PHA02884300 ankyrin repeat protein; Provisional 99.64
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.62
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.6
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.58
PHA02736154 Viral ankyrin protein; Provisional 99.57
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.57
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.53
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.52
PHA02792631 ankyrin-like protein; Provisional 99.52
PHA02792631 ankyrin-like protein; Provisional 99.49
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.46
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.44
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.4
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.37
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.3
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.28
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.27
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.25
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.25
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 99.21
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.18
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.17
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.09
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.05
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 99.04
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.01
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.89
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.75
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.69
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 98.54
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.48
PF1360630 Ank_3: Ankyrin repeat 98.44
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.4
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.39
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.36
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.36
PF1360630 Ank_3: Ankyrin repeat 98.35
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.34
KOG0522560 consensus Ankyrin repeat protein [General function 98.21
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.21
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.19
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 98.12
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.1
KOG0522560 consensus Ankyrin repeat protein [General function 98.06
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 97.94
KOG0511516 consensus Ankyrin repeat protein [General function 97.93
KOG0520975 consensus Uncharacterized conserved protein, conta 97.91
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.9
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.85
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.79
KOG0511516 consensus Ankyrin repeat protein [General function 97.79
KOG2384223 consensus Major histocompatibility complex protein 97.67
KOG2384223 consensus Major histocompatibility complex protein 97.61
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.52
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 97.48
smart0035627 ZnF_C3H1 zinc finger. 97.44
KOG0520975 consensus Uncharacterized conserved protein, conta 97.3
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.04
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 96.75
KOG2505591 consensus Ankyrin repeat protein [General function 96.49
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.24
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.94
KOG1040325 consensus Polyadenylation factor I complex, subuni 95.62
smart0035627 ZnF_C3H1 zinc finger. 95.3
KOG2505591 consensus Ankyrin repeat protein [General function 94.41
KOG3702681 consensus Nuclear polyadenylated RNA binding prote 93.99
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 93.94
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 93.48
KOG2333 614 consensus Uncharacterized conserved protein [Gener 92.92
COG5252299 Uncharacterized conserved protein, contains CCCH-t 92.85
KOG1763343 consensus Uncharacterized conserved protein, conta 92.23
KOG1040325 consensus Polyadenylation factor I complex, subuni 91.66
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 89.91
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 89.33
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.68
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 88.39
COG5152259 Uncharacterized conserved protein, contains RING a 86.79
KOG3702681 consensus Nuclear polyadenylated RNA binding prote 82.29
KOG2185486 consensus Predicted RNA-processing protein, contai 82.0
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 81.31
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 80.8
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 80.31
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=7.6e-71  Score=591.55  Aligned_cols=412  Identities=45%  Similarity=0.695  Sum_probs=329.0

Q ss_pred             HHHHHHcCCHHHHHHHHhcCCCCCcccccccccccCCccccCCCCchHHHHHhcCCHHHHHHHHHhcCCCccccCCCCCC
Q 006947           45 LLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKS  124 (624)
Q Consensus        45 Lh~AA~~Gdle~Vk~LLe~~GadvN~~~l~~~~~~~~~~~D~~G~TPLhlAA~~G~~eiVklLL~~~GADVN~~~d~~G~  124 (624)
                      |-+.++.+|++-+|.++++....++..++||.+..+.+.+..+.+|+|++|+.+|.++++.+++...-.++|..|..++.
T Consensus        15 ~~e~~~~~~~~~~k~~~~e~~~~~~~~~~~~r~~~~~k~~~~~qR~~~~v~~~~Gs~~~~~~i~~~~~~e~~~~C~~~~~   94 (528)
T KOG1595|consen   15 LSEFEAPNDYAYLKEFRVEQPLFLQHKCLQHRPFVCFKWHFLNQRRRRPVARRDGSFNYSPDIYCTKYDEVTGICPDGDE   94 (528)
T ss_pred             chhhccccHHHHHHHHHHhchhhhhhhhcccccchhhhhhhhccccccchhhhcCccccccceeecchhhccccCCCCcc
Confidence            33778889999999999988999999999999999999999999999999999999999999998767899998765554


Q ss_pred             hHHHHHHhCCCCChHHHHHHHHHCCCCCCCcCCCCCcHH---HHHhcCCChhhHHHHHHHHHHCCCCCcccccccccccC
Q 006947          125 TALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPV---DVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSN  201 (624)
Q Consensus       125 TPLH~Aa~~G~~~~~eiVklLL~~GAD~n~~D~~G~TPL---hlAa~~g~~~~~~~lLe~LL~~gadv~~~~~l~~a~~~  201 (624)
                         |+++.+...+.+|.+..|+.+++..+.+|..|+-+.   |.|..+ ...+.+..++.|++.+. .            
T Consensus        95 ---~C~~~g~s~~~~e~~~hL~~~k~~~~~tda~g~~~~~v~~~~~~~-~~~~~r~~~~~l~e~~~-~------------  157 (528)
T KOG1595|consen   95 ---HCAVLGRSVGDTERTYHLRYYKTLPCVTDARGNCVKNVLHCAFAH-GPNDLRPPVEDLLELQG-G------------  157 (528)
T ss_pred             ---cchhcccccCCcceeEeccccccccCccccCCCcccCcccccccC-CccccccHHHHHHhccc-c------------
Confidence               888887777779999999999999999999998764   444442 23455666666666551 0            


Q ss_pred             CCCChhhhhhhcCCCCCCCCCCCCccccCCCCccccccccCCCCCCCCccccCccccccccccccccccCCCccCCCCcc
Q 006947          202 SNSPPLSPALENGSPTSASGSPMKSMSVDAPSFSVSEKKEYPIDPSLPDIKNSIYSTDEFRMYSFKVRPCSRAYSHDWTE  281 (624)
Q Consensus       202 ~g~TpL~lA~e~Gs~~~a~~s~~~~~~~~~a~~s~sekkeyp~D~slpdiknsiYssDeFrmy~fKt~pC~r~~sh~w~~  281 (624)
                                 .|........+.           .....+|++|+++|||+ ++|++|+||||.|||++|.|.+|||||+
T Consensus       158 -----------~~~~~~e~~~~~-----------~~~~~~y~~Dp~~pdi~-~~ys~DeFrMy~fKir~C~R~~shDwte  214 (528)
T KOG1595|consen  158 -----------SGLPDDEPEVES-----------KLDVTEYPEDPSWPDIN-GIYSSDEFRMYSFKIRRCSRPRSHDWTE  214 (528)
T ss_pred             -----------cCccCCCccccc-----------ccccccccCCCCccccc-ccccccceEEEeeeecccCCccCCCccc
Confidence                       010000000000           01122999999999999 9999999999999999999999999999


Q ss_pred             CCCCCCCcccccCCCCCCcccccCCCCCCCCcCCCCCccccccccceeecCCCccccccccCCCCCCCCccCCCCCCCCc
Q 006947          282 CPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCARRVCFFAHTPEEL  361 (624)
Q Consensus       282 Cpf~H~~~~~rRr~p~~~~y~~~~C~~~~~g~C~~gd~C~~aH~~~E~~~hP~~ykT~~C~~~~~C~~~~C~FaH~~~el  361 (624)
                      |||+|||||+||||||||+|++++||+|++|.|++||.|+||||+||+|+||.+|||++||++|+|+|++|||||.++||
T Consensus       215 CPf~HpgEkARRRDPRkyhYs~tpCPefrkG~C~rGD~CEyaHgvfEcwLHPa~YRT~~CkDg~~C~RrvCfFAH~~eqL  294 (528)
T KOG1595|consen  215 CPFAHPGEKARRRDPRKYHYSSTPCPEFRKGSCERGDSCEYAHGVFECWLHPARYRTRKCKDGGYCPRRVCFFAHSPEQL  294 (528)
T ss_pred             CCccCCCcccccCCcccccccCccCcccccCCCCCCCccccccceehhhcCHHHhccccccCCCCCccceEeeecChHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccCCCCCCCC-CCCCCCCCcchhhhhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCcccCC
Q 006947          362 RPLYVSTGSAVPS-PRSSTSGATAMDFAAALSLLPGSPSSVNVMSPSPFTPPMSPSANGISH--SNVAWPQPNVPALHLP  438 (624)
Q Consensus       362 r~~~~~~~~~~~s-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~sp~~~~~~~--~~~~~~~~~~~~~~~~  438 (624)
                      |+++.++|+.+++ |+++++    .++.        +.......+|++.+||+||++++.++  ..+.|.+.++.++..|
T Consensus       295 R~l~~s~~s~~~~sp~~s~~----sp~~--------~~~~~~~~s~~~~~~p~sp~~~~~~~~~~~~~s~~~~~~~~~~p  362 (528)
T KOG1595|consen  295 RPLPPSTGSDRPSSPSSSSA----SPMM--------ASLRSLPFSPSPGSPPLSPSANGVSSPIASGGSRSLNSNSPSSP  362 (528)
T ss_pred             cccCCCCCCCCCCCcccccC----CCCc--------cccccCCCCCCCCCCCCCccccccccccccccccccCCCCCCCc
Confidence            9999999999997 665431    1111        11122334555689999999986544  5678999999999999


Q ss_pred             CCccch-hhhhccccCCCCCccccCCCCCchHHHHHHhhhhccCCCCCCCCCcccCCCCCCCCCCchhhhhhccCCCCch
Q 006947          439 GSNLQS-SRLRSSLNARDMPVDDFNMLPDFDVQQQQLLNELSTLSQPTLSSSLNRSGRMKTLTPSNLDDLFSAESSSPRY  517 (624)
Q Consensus       439 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  517 (624)
                      +.+|+. |||++.++|||+   +  +.-.++                     +.           ||+++|++++++   
T Consensus       363 ~~~~~~~Srl~s~~~a~~i---~--~~~~~~---------------------~~-----------~l~~~f~s~~ss---  402 (528)
T KOG1595|consen  363 AAPLRSFSRLSSSLSAADI---S--MSSPMN---------------------LG-----------NLSELFSSPDSS---  402 (528)
T ss_pred             ccccccccccccccccccc---c--cccccc---------------------cc-----------cchhhhcCcccc---
Confidence            999999 999999999998   2  222222                     00           899999999873   


Q ss_pred             hhhhhhhhhcCccchhhhhhHHHHHHhhhcccccccC--CCCCCCC-Cccc
Q 006947          518 ADQALAAAVFSPTHKSAVLNQFQQQQQQSMLSPINTN--FSPKNVD-HPLL  565 (624)
Q Consensus       518 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~-~~~~  565 (624)
                                      ++.+|+|+. ++.+++|+.++  .....++ +++.
T Consensus       403 ----------------sl~~~~~~~-~~~~tsP~~~~~~~~~~~~e~s~~~  436 (528)
T KOG1595|consen  403 ----------------SLNPQLQVL-SSAPTSPVFTDTASFGSSVESSPAM  436 (528)
T ss_pred             ----------------ccchhhhhc-ccCCcCCcCCcccccccccccchhh
Confidence                            233455544 36777888776  4434444 4444

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3702 consensus Nuclear polyadenylated RNA binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG3702 consensus Nuclear polyadenylated RNA binding protein [RNA processing and modification] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query624
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-07
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 6e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 9e-05
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 9e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-04
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 3e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 5e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-04
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 41/92 (44%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
Query: 89  RTPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAA 148
           RTPL +AA  G +++++L+L E+GADVN    N + T LH AA  G L   +VVKLLL A
Sbjct: 3   RTPLHLAARNGHLEVVKLLL-EAGADVNAKDKNGR-TPLHLAARNGHL---EVVKLLLEA 57
Query: 149 GADPNFVDAKGHHPVDVIVVPPKFQDVRLTLE 180
           GAD N  D  G  P+ +       + V+L LE
Sbjct: 58  GADVNAKDKNGRTPLHLAARNGHLEVVKLLLE 89
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query624
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-06
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 6e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 5e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-04
2rfa_A232 Transient receptor potential cation channel subfa 7e-14
2rfa_A232 Transient receptor potential cation channel subfa 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-12
2rfa_A232 Transient receptor potential cation channel subfa 6e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-07
2etb_A256 Transient receptor potential cation channel subfam 6e-11
2etb_A256 Transient receptor potential cation channel subfam 4e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2etb_A256 Transient receptor potential cation channel subfam 1e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-06
2pnn_A273 Transient receptor potential cation channel subfa 6e-11
2pnn_A273 Transient receptor potential cation channel subfa 8e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-05
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-10
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 3e-10
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 3e-10
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 2e-09
2rhk_C72 Cleavage and polyadenylation specificity factor su 8e-09
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-05
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 3e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-05
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 6e-04
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
 Score = 85.6 bits (213), Expect = 1e-19
 Identities = 28/100 (28%), Positives = 41/100 (41%), Gaps = 17/100 (17%)

Query: 73  LWYGRQKGSKQMV---------NEQ----RTPLMVAATYGSIDIIRLILSESGADVNLSC 119
            W   +K  +Q +         +      RT L+  A  GS   +RL+    GAD++   
Sbjct: 48  WWTAARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEA-GADLDHRD 106

Query: 120 GNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKG 159
                TALH AA        +VV+ L+  GAD    D +G
Sbjct: 107 MRGGLTALHMAAGYVRP---EVVEALVELGADIEVEDERG 143
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Length = 70 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Length = 83 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Length = 80 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query624
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.92
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.91
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.91
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.9
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.9
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.9
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.9
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.9
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.9
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
2pnn_A273 Transient receptor potential cation channel subfa 99.9
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.9
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.9
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.9
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.9
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.9
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.89
3hra_A201 Ankyrin repeat family protein; structural protein; 99.89
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.88
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.88
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.88
2etb_A256 Transient receptor potential cation channel subfam 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.88
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.88
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.88
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.87
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.87
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.87
2pnn_A273 Transient receptor potential cation channel subfa 99.87
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.87
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.85
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.8
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.79
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.78
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.76
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.73
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.73
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.65
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.65
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.63
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.39
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.96
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 98.61
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.59
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.51
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.47
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.47
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.26
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.08
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 97.77
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 97.76
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 97.47
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 97.34
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 97.21
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 96.63
2rhk_C72 Cleavage and polyadenylation specificity factor su 96.29
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 94.46
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 94.76
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 93.24
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 92.88
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 89.43
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 84.31
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.95  E-value=7.2e-27  Score=223.15  Aligned_cols=143  Identities=34%  Similarity=0.501  Sum_probs=135.3

Q ss_pred             HHHHHHHHcCCHHHHHHHHhcCCCCCcccccccccccCCccccCCCCchHHHHHhcCCHHHHHHHHHhcCCCccccCCCC
Q 006947           43 ASLLELAANNDVEGFKRSIVCDPSGVDEVGLWYGRQKGSKQMVNEQRTPLMVAATYGSIDIIRLILSESGADVNLSCGND  122 (624)
Q Consensus        43 TpLh~AA~~Gdle~Vk~LLe~~GadvN~~~l~~~~~~~~~~~D~~G~TPLhlAA~~G~~eiVklLL~~~GADVN~~~d~~  122 (624)
                      +.|+.||..|++++|+.||+ .|+|+|..             |.+|+||||+|+..|+.+++++||+. |+|++.+ +.+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~-~Gadvn~~-------------d~~g~t~l~~a~~~~~~~~~~~ll~~-gad~~~~-d~~   69 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIE-NGADVNAS-------------DSDGRTPLHHAAENGHKEVVKLLISK-GADVNAK-DSD   69 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHH-TTCCTTCC-------------CTTSCCHHHHHHHTTCHHHHHHHHHT-TCCTTCC-CTT
T ss_pred             HHHHHHHHcCCHHHHHHHHH-CCCCCCCc-------------CCCCCCHHHHHHHcCCHHHHHHHHhc-ccchhhh-ccC
Confidence            57999999999999999999 99999987             68999999999999999999999998 9999999 999


Q ss_pred             CChHHHHHHhCCCCChHHHHHHHHHCCCCCCCcCCCCCcHHHHHhcCCChhhHHHHHHHHHHCCCCCcccccccccccCC
Q 006947          123 KSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVPPKFQDVRLTLEELLATDGSVERNLRVSTTTSNS  202 (624)
Q Consensus       123 G~TPLH~Aa~~G~~~~~eiVklLL~~GAD~n~~D~~G~TPLhlAa~~g~~~~~~~lLe~LL~~gadv~~~~~l~~a~~~~  202 (624)
                      |+||||+|+..|+   .++|++||++|+|+|.+|.+|+||||+|+.    .+..+++++|++.|++++       ..+..
T Consensus        70 g~TpLh~A~~~g~---~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~----~g~~~~v~~Ll~~gad~~-------~~d~~  135 (169)
T 4gpm_A           70 GRTPLHHAAENGH---KEVVKLLISKGADVNAKDSDGRTPLHHAAE----NGHKEVVKLLISKGADVN-------TSDSD  135 (169)
T ss_dssp             SCCHHHHHHHTTC---HHHHHHHHHTTCCTTCCCTTSCCHHHHHHH----TTCHHHHHHHHHTTCCTT-------CCCTT
T ss_pred             CCCHHHHHHHcCC---HHHHHHHHHCcCCCCCCCCCCCCHHHHHHH----cCCHHHHHHHHHcCCCcc-------ccCCC
Confidence            9999999999999   999999999999999999999999999999    455678999999999998       78889


Q ss_pred             CCChhhhhhhcCC
Q 006947          203 NSPPLSPALENGS  215 (624)
Q Consensus       203 g~TpL~lA~e~Gs  215 (624)
                      |.|||++|++.|.
T Consensus       136 G~TpL~~A~~~g~  148 (169)
T 4gpm_A          136 GRTPLDLAREHGN  148 (169)
T ss_dssp             SCCHHHHHHHTTC
T ss_pred             CCCHHHHHHHcCC
Confidence            9999999999984
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 624
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 1e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 0.001
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 7e-04
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.2 bits (181), Expect = 8e-15
 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 90  TPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAG 149
           TPL VA+  G + I++ +L + GA  N        T LH AA  G     +V K LL   
Sbjct: 2   TPLHVASFMGHLPIVKNLL-QRGASPN-VSNVKVETPLHMAARAGHT---EVAKYLLQNK 56

Query: 150 ADPNFVDAKGHHP 162
           A  N        P
Sbjct: 57  AKVNAKAKDDQTP 69
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query624
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.89
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.87
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.85
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.85
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.84
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.82
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.81
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.81
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.77
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.77
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.76
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.76
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.74
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.73
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.72
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.68
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.68
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.54
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 98.86
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 98.82
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 98.8
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 98.78
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 98.75
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 98.67
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 95.44
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 92.64
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 87.04
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=1.5e-24  Score=211.25  Aligned_cols=167  Identities=21%  Similarity=0.255  Sum_probs=148.1

Q ss_pred             cCCCCcccCccChHHHHHHHHcCCHHHHHHHHhcCCCCCcccc--------------------cccccccCCccccCCCC
Q 006947           30 DMNHLTVETDDAFASLLELAANNDVEGFKRSIVCDPSGVDEVG--------------------LWYGRQKGSKQMVNEQR   89 (624)
Q Consensus        30 d~~~ini~d~dg~TpLh~AA~~Gdle~Vk~LLe~~GadvN~~~--------------------l~~~~~~~~~~~D~~G~   89 (624)
                      ....++.+|.+|+||||+||..|+.++++.|+. .+.+.....                    +++.++.+.+..|.+|.
T Consensus        26 ~~~~~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~~d~~~~d~~g~  104 (223)
T d1uoha_          26 DKSLATRTDQDSRTALHWACSAGHTEIVEFLLQ-LGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGC  104 (223)
T ss_dssp             CGGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHH-HTCCSCCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTCC
T ss_pred             CCCcCcCcCCCCCCHHHHHHHhhhhcccccccc-cccccccccccccccccccccccccchhHHHhccCceeEeeCCCCC
Confidence            345678899999999999999999999999998 544443321                    45667778888999999


Q ss_pred             chHHHHHhcCCHHHHHHHHHhcCCCccccCCCCCChHHHHHHhCCCCChHHHHHHHHHCCCCCCCcCCCCCcHHHHHhcC
Q 006947           90 TPLMVAATYGSIDIIRLILSESGADVNLSCGNDKSTALHCAASGGALNAVDVVKLLLAAGADPNFVDAKGHHPVDVIVVP  169 (624)
Q Consensus        90 TPLhlAA~~G~~eiVklLL~~~GADVN~~~d~~G~TPLH~Aa~~G~~~~~eiVklLL~~GAD~n~~D~~G~TPLhlAa~~  169 (624)
                      ||||+|+.+|+.+++++|+++ |++++.+ +.+|.||||+|+..++   .+++++|+..|++++.+|..|+||||+|+..
T Consensus       105 tpL~~A~~~~~~e~~~~Ll~~-g~d~~~~-~~~~~t~L~~a~~~~~---~~~~~~L~~~~~~i~~~d~~g~TpL~~Aa~~  179 (223)
T d1uoha_         105 TPLHYAASKNRHEIAVMLLEG-GANPDAK-DHYEATAMHRAAAKGN---LKMIHILLYYKASTNIQDTEGNTPLHLACDE  179 (223)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT-TCCTTCC-CTTSCCHHHHHHHTTC---HHHHHHHHHTTCCSCCCCTTCCCHHHHHHHT
T ss_pred             chhhHHHHcCCHHHHHHHHHC-CCCCCCc-CCCCCccchhhhhcCC---cchhhhhccccceeeeccCCCCceecccccc
Confidence            999999999999999999988 9999998 9999999999999999   9999999999999999999999999999994


Q ss_pred             CChhhHHHHHHHHHHCCCCCcccccccccccCCCCChhhhhhhcC
Q 006947          170 PKFQDVRLTLEELLATDGSVERNLRVSTTTSNSNSPPLSPALENG  214 (624)
Q Consensus       170 g~~~~~~~lLe~LL~~gadv~~~~~l~~a~~~~g~TpL~lA~e~G  214 (624)
                          +..+++++|++.|++++       ..+..|.|||++|. .|
T Consensus       180 ----g~~~~v~~LL~~Gad~~-------~~d~~g~tpl~~A~-~~  212 (223)
T d1uoha_         180 ----ERVEEAKLLVSQGASIY-------IENKEEKTPLQVAK-GG  212 (223)
T ss_dssp             ----TCHHHHHHHHHTTCCSC-------CCCTTSCCHHHHCC-TT
T ss_pred             ----CcHHHHHHHHHCCCCCC-------CCCCCCCCHHHHHH-CC
Confidence                55678999999999998       78899999999983 44
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure