Citrus Sinensis ID: 007005


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
cccEEEEEccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHccccccccccccHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccccEEEEEHHHccccEEEEEccccccccccccHHHHHHHHcc
cccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEccHHcHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEHHHccHHHHHHHHHHHHcHHcccccccccEcEEEEEEcccccccccEEEEEEEEccccEEEEEccccccHcccccHHHHHHHHHc
MLEQLLIFTRGGLILWTCKELgnalkgspidTLIRSCLLEersglasfnydsagaaYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFseiydpkrtdysdFDEMFRQLRKEAEARAEELKKSKqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnmrgrklenghsnvgnveieesrvtgvangkentssnigafdvSKLQKLRnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngsnieveaadhgesmmdkeevfssdseseedeevgkhnkpdakktgwfSSMFQSIAgkanldkaDLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLqvpifekgyekdpAIVAKEAIQEATRNGSDVVLVDtagrmqdnePLMRALSKLiylnnpdlVLFVGEALVGNDAVDQLSKFNQKladlssspnpqlidgilltkfdtiDDKVGAALSMVYVSgapvmfvgcgqsytdlkKLNVKSIVKTLLK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSeiydpkrtdySDFDEMFRQLRKEAEARAEElkkskqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLenghsnvgnveieESRVTgvangkentssnigafdvsklqklrnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngSNIEVEaadhgesmMDKEEVFssdseseedeevgkhnkpdakktgwFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAaslegkklaSFTRISSIVQAAMEEALVRILTPRRSIDILRDVhaakeqrkpyVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRlqvpifekgyekdpAIVAKEAIqeatrngsdvVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLadlssspnpqLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQsytdlkklnvkSIVKTLLK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQlrkeaearaeelkkSKQVTKPMNNlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKeevfssdseseedeevGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYvvvfvgvngvgKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
***QLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYD***********************************************************************************************************************************************************************************************************************WFSSMFQSIA*************LKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFN************QLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVK****
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRK***********************************************************************************************************************************************************************************************************QSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVH**KEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFER**************DSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQK***********************KITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGE***************************DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEE*******************************************************************************************************************************************************************************************TGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query621 2.2.26 [Sep-21-2011]
Q9DBG7636 Signal recognition partic yes no 0.953 0.930 0.418 1e-132
Q9U5L1614 Signal recognition partic yes no 0.950 0.960 0.434 1e-131
Q3MHE8639 Signal recognition partic yes no 0.951 0.924 0.411 1e-126
P08240638 Signal recognition partic yes no 0.956 0.931 0.415 1e-125
P06625638 Signal recognition partic yes no 0.946 0.921 0.405 1e-124
Q54ZR7615 Signal recognition partic yes no 0.497 0.502 0.596 1e-105
O43032547 Signal recognition partic yes no 0.466 0.530 0.436 2e-66
P32916621 Signal recognition partic yes no 0.628 0.628 0.350 6e-64
Q57739409 Signal recognition partic yes no 0.442 0.672 0.425 4e-51
Q8TIN7417 Signal recognition partic yes no 0.441 0.657 0.402 3e-49
>sp|Q9DBG7|SRPR_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus GN=Srpr PE=1 SV=1 Back     alignment and function desciption
 Score =  471 bits (1213), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 278/664 (41%), Positives = 392/664 (59%), Gaps = 72/664 (10%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           ML+   IF++GGL+LW  + + ++  G P++ LIRS LL+ER G  SF ++    A TLK
Sbjct: 1   MLDFFTIFSKGGLVLWCFQGVSDSCTG-PVNALIRSVLLQERGGNNSFTHE----ALTLK 55

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 56  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 115

Query: 112 MFRQLRKEAEARAE--------ELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGS 163
            F +L +EAE  ++        + + S++  KP+ ++ +  G+  K   E+  N      
Sbjct: 116 DFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKTK---EKAKN------ 166

Query: 164 ANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNK 223
                  +  RG K E     +   +   +  +G++ G EN   +       K ++   K
Sbjct: 167 -------NKKRGAKKEGSDGTLATSKTAPAEKSGLSAGPENGELSKEELIRRKREEFIQK 219

Query: 224 GGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESK--LDFTDPAGGNGS---------N 272
            GK  D       +  PK+K  K  RVW+     +K  LD++ P   NG+         N
Sbjct: 220 HGKGLDKSSKSTKSDTPKEKGKKAPRVWELGGCANKEVLDYSTPTT-NGTPEAALSEDIN 278

Query: 273 IEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKK--TGWFSSMFQSIAGKANL 330
           + +     G  + D       D  S +DE   ++ KP A K   G    M + + G  +L
Sbjct: 279 L-IRGTGPGGQLQD------LDCSSSDDEGATQNTKPSATKGTLGGMFGMLKGLVGSKSL 331

Query: 331 DKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEAL 390
            + D+E  L  ++D L+ KNVA +IA +LCESVA  LEGK + +F+ ++S V+ A++E+L
Sbjct: 332 SREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESL 391

Query: 391 VRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAA 450
           V+IL P+R +D+LRD+  A+ +++PYVV F GVNGVGKSTNLAK+++WLL++  SV++AA
Sbjct: 392 VQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAA 451

Query: 451 CDTFRSGAVEQLRTHARRL-------------QVPIFEKGYEKDPAIVAKEAIQEATRNG 497
           CDTFR+GAVEQLRTH RRL              V +FEKGY KD A +A EAI  A   G
Sbjct: 452 CDTFRAGAVEQLRTHTRRLTALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQG 511

Query: 498 SDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADL 557
            DVVLVDTAGRMQDN PLM AL+KLI +N PDLVLFVGEALVGN+AVDQL KFN+ LAD 
Sbjct: 512 FDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADH 571

Query: 558 SSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVK 617
           S +  P+LIDGI+LTKFDTIDDKVGAA+SM Y++  P++FVG GQ+Y DL+ LN K++V 
Sbjct: 572 SMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVA 631

Query: 618 TLLK 621
            L+K
Sbjct: 632 ALMK 635




Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
Mus musculus (taxid: 10090)
>sp|Q9U5L1|SRPR_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster GN=Gtp-bp PE=1 SV=2 Back     alignment and function description
>sp|Q3MHE8|SRPR_BOVIN Signal recognition particle receptor subunit alpha OS=Bos taurus GN=SRPR PE=2 SV=1 Back     alignment and function description
>sp|P08240|SRPR_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens GN=SRPR PE=1 SV=2 Back     alignment and function description
>sp|P06625|SRPR_CANFA Signal recognition particle receptor subunit alpha OS=Canis familiaris GN=SRPR PE=2 SV=2 Back     alignment and function description
>sp|Q54ZR7|SRPR_DICDI Signal recognition particle receptor subunit alpha OS=Dictyostelium discoideum GN=srpr PE=3 SV=1 Back     alignment and function description
>sp|O43032|SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp101 PE=3 SV=1 Back     alignment and function description
>sp|P32916|SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP101 PE=1 SV=2 Back     alignment and function description
>sp|Q57739|FTSY_METJA Signal recognition particle receptor FtsY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ftsY PE=3 SV=1 Back     alignment and function description
>sp|Q8TIN7|FTSY_METAC Signal recognition particle receptor FtsY OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ftsY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query621
449453958617 PREDICTED: signal recognition particle r 0.991 0.998 0.853 0.0
224091775624 predicted protein [Populus trichocarpa] 0.995 0.990 0.842 0.0
255577019618 signal recognition particle receptor alp 0.990 0.995 0.857 0.0
225445848616 PREDICTED: signal recognition particle r 0.990 0.998 0.850 0.0
297798906633 signal recognition particle receptor alp 0.995 0.976 0.801 0.0
15234792634 signal recognition particle receptor sub 0.995 0.974 0.799 0.0
356517002623 PREDICTED: signal recognition particle r 0.990 0.987 0.793 0.0
357480047631 Signal recognition particle receptor sub 0.975 0.960 0.764 0.0
356562565626 PREDICTED: signal recognition particle r 0.987 0.979 0.753 0.0
212275688625 signal recognition particle receptor hom 0.980 0.974 0.718 0.0
>gi|449453958|ref|XP_004144723.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/622 (85%), Positives = 569/622 (91%), Gaps = 6/622 (0%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           MLEQLLIFTRGGLILWTCKELGNAL+GSPIDTLIRSCLLEERSG AS+NYD+ GAAYTLK
Sbjct: 1   MLEQLLIFTRGGLILWTCKELGNALRGSPIDTLIRSCLLEERSGAASYNYDAPGAAYTLK 60

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEA 120
           WTFHNELGLVFVAVYQRILHLLYVDDLLAM+KQ FSEIYDPKR  Y DFDE FRQLR EA
Sbjct: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMVKQGFSEIYDPKRMVYDDFDETFRQLRMEA 120

Query: 121 EARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLEN 180
           EAR  ELKK+KQV KP+NN +KQG Q QK GF  G N+       DDGD++  +G KLEN
Sbjct: 121 EARTNELKKTKQVGKPLNNARKQG-QDQKTGF--GENKKSNSGLADDGDAERTKGHKLEN 177

Query: 181 GHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDP 240
           G+SN GN  + ES++T V NGKENTSSN+GAFDV+KLQKLR+KGGKKTD V +KGS  +P
Sbjct: 178 GYSN-GN-HVIESKLTAVVNGKENTSSNVGAFDVNKLQKLRSKGGKKTDPVANKGSKEEP 235

Query: 241 KKKITKKNRVWDDSPPESKLDFTDPAGGNG-SNIEVEAADHGESMMDKEEVFSSDSESEE 299
           KKK+TKKNRVWD+ P E+KLDFTDP G NG +NI+V AAD G+SMMDKEEVFSSDSE EE
Sbjct: 236 KKKVTKKNRVWDEKPTEAKLDFTDPVGENGDNNIDVLAADQGQSMMDKEEVFSSDSEDEE 295

Query: 300 DEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKL 359
           DEE  K +KPDAKK GWFSSMFQSI+GKA+LDKADLEPALKALKDRLMTKNVAEEIAEKL
Sbjct: 296 DEEGDKGSKPDAKKKGWFSSMFQSISGKASLDKADLEPALKALKDRLMTKNVAEEIAEKL 355

Query: 360 CESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVV 419
           CESVAASLEGKKLASFTRISS VQAAMEEALVRILTPRRSIDILRDVHAAKEQ+KPYVVV
Sbjct: 356 CESVAASLEGKKLASFTRISSTVQAAMEEALVRILTPRRSIDILRDVHAAKEQKKPYVVV 415

Query: 420 FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYE 479
           FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQ+PIFEKGYE
Sbjct: 416 FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQIPIFEKGYE 475

Query: 480 KDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALV 539
           KDPA+VAKEAIQEA+RNGSDVVLVDTAGRMQDNEPLMRALSKLI LN+PDLVLFVGEALV
Sbjct: 476 KDPAVVAKEAIQEASRNGSDVVLVDTAGRMQDNEPLMRALSKLINLNSPDLVLFVGEALV 535

Query: 540 GNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVG 599
           GNDAVDQLSKFNQKLADLS+SP P+LIDGILLTKFDTIDDKVGAALSMVY+SGAPVMFVG
Sbjct: 536 GNDAVDQLSKFNQKLADLSTSPEPRLIDGILLTKFDTIDDKVGAALSMVYISGAPVMFVG 595

Query: 600 CGQSYTDLKKLNVKSIVKTLLK 621
           CGQSYTDLKKLNVKSIVKTL+K
Sbjct: 596 CGQSYTDLKKLNVKSIVKTLIK 617




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224091775|ref|XP_002309350.1| predicted protein [Populus trichocarpa] gi|222855326|gb|EEE92873.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577019|ref|XP_002529394.1| signal recognition particle receptor alpha subunit, putative [Ricinus communis] gi|223531142|gb|EEF32990.1| signal recognition particle receptor alpha subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225445848|ref|XP_002278056.1| PREDICTED: signal recognition particle receptor subunit alpha [Vitis vinifera] Back     alignment and taxonomy information
>gi|297798906|ref|XP_002867337.1| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata] gi|297313173|gb|EFH43596.1| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234792|ref|NP_194789.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana] gi|7269961|emb|CAB79778.1| signal recognition particle receptor-like protein [Arabidopsis thaliana] gi|18086492|gb|AAL57699.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|22137194|gb|AAM91442.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|332660385|gb|AEE85785.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356517002|ref|XP_003527179.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max] Back     alignment and taxonomy information
>gi|357480047|ref|XP_003610309.1| Signal recognition particle receptor subunit alpha [Medicago truncatula] gi|355511364|gb|AES92506.1| Signal recognition particle receptor subunit alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|356562565|ref|XP_003549540.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max] Back     alignment and taxonomy information
>gi|212275688|ref|NP_001130574.1| signal recognition particle receptor homolog1 [Zea mays] gi|194689526|gb|ACF78847.1| unknown [Zea mays] gi|194707804|gb|ACF87986.1| unknown [Zea mays] gi|414864260|tpg|DAA42817.1| TPA: signal recognition particle receptor-like protein isoform 1 [Zea mays] gi|414864261|tpg|DAA42818.1| TPA: signal recognition particle receptor-like protein isoform 2 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query621
TAIR|locus:2118701634 AT4G30600 [Arabidopsis thalian 0.996 0.976 0.718 1.3e-226
DICTYBASE|DDB_G0277377615 srpR "signal recognition parti 0.689 0.695 0.449 9.8e-116
FB|FBgn0010391614 Gtp-bp "GTP-binding protein" [ 0.497 0.503 0.580 5.7e-115
UNIPROTKB|F1NXV4644 SRPR "Uncharacterized protein" 0.507 0.489 0.557 5.7e-109
UNIPROTKB|Q3MHE8639 SRPR "Signal recognition parti 0.505 0.491 0.547 1.5e-108
ZFIN|ZDB-GENE-030219-11650 srpr "signal recognition parti 0.695 0.664 0.443 1.9e-106
MGI|MGI:1914648636 Srpr "signal recognition parti 0.510 0.498 0.542 5.8e-105
RGD|1311504636 Srpr "signal recognition parti 0.510 0.498 0.542 5.8e-105
UNIPROTKB|P08240638 SRPR "Signal recognition parti 0.505 0.492 0.547 9.4e-105
UNIPROTKB|F1S754638 SRPR "Uncharacterized protein" 0.505 0.492 0.544 1.2e-104
TAIR|locus:2118701 AT4G30600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2187 (774.9 bits), Expect = 1.3e-226, P = 1.3e-226
 Identities = 457/636 (71%), Positives = 501/636 (78%)

Query:     1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
             MLEQLLIFTRGGLILWTCKE+GNALKGSPIDTLIRSCLLEERSG  SFNYD+ GAAYTLK
Sbjct:     1 MLEQLLIFTRGGLILWTCKEIGNALKGSPIDTLIRSCLLEERSGAVSFNYDAPGAAYTLK 60

Query:    61 WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQXXXXX 120
             WTFHN+LGLVFVAVYQRILHLLYVDDLL+M+KQSFSE+YDPKR  Y DFDE FRQ     
Sbjct:    61 WTFHNDLGLVFVAVYQRILHLLYVDDLLSMVKQSFSEVYDPKRMAYDDFDETFRQLRIEA 120

Query:   121 XXXXXXXXXSKQVTKPMNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRGR--KL 178
                      +KQV KP+ +                                  + +   L
Sbjct:   121 EARAEELRKTKQVGKPVTSVKKQGQVSKPGLEGGNKRVSSEGGSKKDDGDGGNKAKVSTL 180

Query:   179 ENGHSNVGNVEIEE-SRVTG-VANGKENTSSNIGAFDVSKLQKLRNKG--GK----KTDT 230
              NGHSN GN ++E+ S+ T  +ANGKENTSSN+ A D+SKLQKLR+KG  G+    KTD+
Sbjct:   181 TNGHSN-GNHQMEDDSQETNDLANGKENTSSNV-AVDLSKLQKLRSKGVRGRGGVRKTDS 238

Query:   231 VVSKGSN-PDPKKKITKKNRVWDDSPP-ESKLDFTDPAGGNGSN--IEVEAADHGESMMD 286
             + +K S   +P KK TKKNRVWDD+ P +SKLDFTD    NG+N  +++ AAD GESMMD
Sbjct:   239 IGNKSSKVAEPAKKATKKNRVWDDAAPKQSKLDFTDSIDENGNNDHVDIVAADQGESMMD 298

Query:   287 KXXXXXXXXXXXXXXXXGKHNKP-DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDR 345
             K                G   KP  AKK GWFSS+FQSI GKANL++ DL PALKALK+R
Sbjct:   299 KEEVFSSDSESEDDDEPGSDEKPAQAKKKGWFSSVFQSITGKANLERTDLGPALKALKER 358

Query:   346 LMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRD 405
             LMTKNVAEEIAEKLCESV ASLEGKKL+SFTRISS VQAAME+ALVRILTPRRSIDILRD
Sbjct:   359 LMTKNVAEEIAEKLCESVEASLEGKKLSSFTRISSTVQAAMEDALVRILTPRRSIDILRD 418

Query:   406 VHAAKEQRKPYXXXXXXXXXXXKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTH 465
             VHAAKEQRKPY           KSTNLAKVAYWL QHKVSVMMAACDTFRSGAVEQLRTH
Sbjct:   419 VHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTFRSGAVEQLRTH 478

Query:   466 ARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYL 525
             ARRLQ+PIFEKGYEKDPA+VAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLI L
Sbjct:   479 ARRLQIPIFEKGYEKDPAVVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLINL 538

Query:   526 NNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAAL 585
             N PDLVLFVGEALVGNDAVDQLSKFNQKL+DLS+S NP+LIDGILLTKFDTIDDKVGAAL
Sbjct:   539 NQPDLVLFVGEALVGNDAVDQLSKFNQKLSDLSTSGNPRLIDGILLTKFDTIDDKVGAAL 598

Query:   586 SMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 621
             SMVY+SG+PVMFVGCGQSYTDLKKLNVK+IVKTLLK
Sbjct:   599 SMVYISGSPVMFVGCGQSYTDLKKLNVKAIVKTLLK 634




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0005047 "signal recognition particle binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005786 "signal recognition particle, endoplasmic reticulum targeting" evidence=ISS
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0006605 "protein targeting" evidence=ISS
GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
DICTYBASE|DDB_G0277377 srpR "signal recognition particle receptor alpha subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0010391 Gtp-bp "GTP-binding protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXV4 SRPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHE8 SRPR "Signal recognition particle receptor subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030219-11 srpr "signal recognition particle receptor (docking protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914648 Srpr "signal recognition particle receptor ('docking protein')" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311504 Srpr "signal recognition particle receptor ('docking protein')" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P08240 SRPR "Signal recognition particle receptor subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S754 SRPR "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DBG7SRPR_MOUSENo assigned EC number0.41860.95330.9308yesno
P08240SRPR_HUMANNo assigned EC number0.41560.95650.9310yesno
P06625SRPR_CANFANo assigned EC number0.40590.94680.9216yesno
Q3MHE8SRPR_BOVINNo assigned EC number0.41160.95160.9248yesno
Q9U5L1SRPR_DROMENo assigned EC number0.43410.95000.9609yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Pr 7e-90
COG0552340 COG0552, FtsY, Signal recognition particle GTPase 5e-85
smart00962197 smart00962, SRP54, SRP54-type protein, GTPase doma 3e-79
cd03115173 cd03115, SRP, The signal recognition particle (SRP 3e-78
pfam00448196 pfam00448, SRP54, SRP54-type protein, GTPase domai 3e-66
TIGR00064272 TIGR00064, ftsY, signal recognition particle-docki 8e-64
COG0541 451 COG0541, Ffh, Signal recognition particle GTPase [ 7e-56
pfam04086272 pfam04086, SRP-alpha_N, Signal recognition particl 2e-53
PRK10416318 PRK10416, PRK10416, signal recognition particle-do 2e-52
TIGR00959 428 TIGR00959, ffh, signal recognition particle protei 4e-51
PRK10867 433 PRK10867, PRK10867, signal recognition particle pr 4e-50
PRK00771 437 PRK00771, PRK00771, signal recognition particle pr 6e-39
TIGR01425 429 TIGR01425, SRP54_euk, signal recognition particle 2e-31
COG1419407 COG1419, FlhF, Flagellar GTP-binding protein [Cell 7e-23
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 1e-21
TIGR03499283 TIGR03499, FlhF, flagellar biosynthetic protein Fl 1e-17
PRK12726407 PRK12726, PRK12726, flagellar biosynthesis regulat 3e-14
PRK12724432 PRK12724, PRK12724, flagellar biosynthesis regulat 2e-11
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-10
PRK06731270 PRK06731, flhF, flagellar biosynthesis regulator F 2e-09
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulat 2e-08
PRK11889436 PRK11889, flhF, flagellar biosynthesis regulator F 5e-08
PRK14722374 PRK14722, flhF, flagellar biosynthesis regulator F 5e-07
smart0096377 smart00963, SRP54_N, SRP54-type protein, helical b 1e-06
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 3e-06
pfam0288177 pfam02881, SRP54_N, SRP54-type protein, helical bu 4e-04
PRK12723388 PRK12723, PRK12723, flagellar biosynthesis regulat 5e-04
PRK14721420 PRK14721, flhF, flagellar biosynthesis regulator F 8e-04
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 0.002
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 0.004
>gnl|CDD|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
 Score =  281 bits (721), Expect = 7e-90
 Identities = 137/335 (40%), Positives = 199/335 (59%), Gaps = 15/335 (4%)

Query: 286 DKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDR 345
             EE    + E E  E   +  + D ++       F        + + D+E  L+ L+  
Sbjct: 15  KVEEKIEEEEEEEAPEAEEEEEEEDEEEKKEKPGFFDKAKITE-IKEKDIEDLLEELELE 73

Query: 346 LMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRD 405
           L+  +VA E+AE++ ES+   L GKK+     +  IV+ A++EAL+ +L+     D++ +
Sbjct: 74  LLESDVALEVAEEILESLKEKLVGKKVKRGEDVEEIVKNALKEALLEVLSVGDLFDLIEE 133

Query: 406 VHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTH 465
           +   K + KP V+VFVGVNG GK+T +AK+AY+L ++  SV++AA DTFR+GA+EQL  H
Sbjct: 134 I---KSKGKPVVIVFVGVNGTGKTTTIAKLAYYLKKNGFSVVIAAGDTFRAGAIEQLEEH 190

Query: 466 ARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYL 525
           A RL V + +  Y  DPA VA +AI+ A   G DVVL+DTAGRM  +  LM  L K++ +
Sbjct: 191 AERLGVKVIKHKYGADPAAVAYDAIEHAKARGIDVVLIDTAGRMHTDANLMDELKKIVRV 250

Query: 526 NNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAAL 585
             PDLV+FVG+AL GNDAV+Q  +FN+ +           IDG++LTK D  D K GAAL
Sbjct: 251 TKPDLVIFVGDALAGNDAVEQAREFNEAVG----------IDGVILTKVDA-DAKGGAAL 299

Query: 586 SMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLL 620
           S+ YV G P++F+G GQ Y DL   +    V  LL
Sbjct: 300 SIAYVIGKPILFLGVGQGYDDLIPFDPDWFVDKLL 334


Length = 336

>gnl|CDD|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214940 smart00962, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|215925 pfam00448, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY Back     alignment and domain information
>gnl|CDD|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal Back     alignment and domain information
>gnl|CDD|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein Back     alignment and domain information
>gnl|CDD|236780 PRK10867, PRK10867, signal recognition particle protein; Provisional Back     alignment and domain information
>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 Back     alignment and domain information
>gnl|CDD|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 621
KOG0781587 consensus Signal recognition particle receptor, al 100.0
COG0552340 FtsY Signal recognition particle GTPase [Intracell 100.0
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 100.0
PRK14974336 cell division protein FtsY; Provisional 100.0
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 100.0
KOG0780 483 consensus Signal recognition particle, subunit Srp 100.0
PRK10867 433 signal recognition particle protein; Provisional 100.0
PRK00771 437 signal recognition particle protein Srp54; Provisi 100.0
PRK10416318 signal recognition particle-docking protein FtsY; 100.0
TIGR00959 428 ffh signal recognition particle protein. This mode 100.0
TIGR00064272 ftsY signal recognition particle-docking protein F 100.0
PF04086279 SRP-alpha_N: Signal recognition particle, alpha su 100.0
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 100.0
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 100.0
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 100.0
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 100.0
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 100.0
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 100.0
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 99.97
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 99.97
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 99.97
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 99.96
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.92
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.92
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.91
COG1127263 Ttg2A ABC-type transport system involved in resist 99.91
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.91
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.9
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.9
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.89
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.89
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.89
COG4152300 ABC-type uncharacterized transport system, ATPase 99.89
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.89
PRK13537306 nodulation ABC transporter NodI; Provisional 99.88
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.88
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.88
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.87
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.87
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.87
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.86
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.86
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.86
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.86
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.86
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.86
COG0410237 LivF ABC-type branched-chain amino acid transport 99.86
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.86
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.86
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.86
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.86
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.86
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.86
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.85
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.85
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.85
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.85
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.85
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.85
COG0411250 LivG ABC-type branched-chain amino acid transport 99.85
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.85
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.85
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.85
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.85
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.85
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.85
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.85
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.85
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.85
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.85
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.85
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.85
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.85
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.85
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.85
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.84
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.84
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.84
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.84
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.84
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
cd03115173 SRP The signal recognition particle (SRP) mediates 99.84
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.84
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.84
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.84
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.84
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.84
COG4181228 Predicted ABC-type transport system involved in ly 99.84
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.84
PRK10908222 cell division protein FtsE; Provisional 99.84
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.84
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.84
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.84
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.84
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.84
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.84
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.84
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.84
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.84
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.84
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.84
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.83
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.83
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.83
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.83
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.83
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.83
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.83
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.83
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.83
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.83
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.83
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.83
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.83
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.83
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.83
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.83
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.83
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.83
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.82
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.82
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.82
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.82
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.82
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.82
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.82
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.82
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.82
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.82
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.82
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.82
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.82
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.82
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.82
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.82
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.82
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.82
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.82
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.82
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.82
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.82
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.82
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.82
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.82
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.81
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.81
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.81
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
COG4586325 ABC-type uncharacterized transport system, ATPase 99.81
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.81
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.81
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.81
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.81
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.81
COG4559259 ABC-type hemin transport system, ATPase component 99.81
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.81
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.81
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.81
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.81
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.81
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.81
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.81
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.81
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.81
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.81
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.81
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.81
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.81
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.81
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.81
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.81
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.81
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.81
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.81
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.8
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.8
cd03246173 ABCC_Protease_Secretion This family represents the 99.8
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.8
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.8
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.8
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.8
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.8
PRK09984262 phosphonate/organophosphate ester transporter subu 99.8
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.8
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.8
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.8
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.8
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.8
cd03234226 ABCG_White The White subfamily represents ABC tran 99.8
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.8
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.8
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.8
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.8
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.8
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.8
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.8
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.8
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.8
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.8
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.8
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.8
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.8
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.8
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.8
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.79
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.79
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.79
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.79
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.79
COG4619223 ABC-type uncharacterized transport system, ATPase 99.79
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.79
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.79
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.79
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.79
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.79
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.79
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.79
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.79
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.79
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.79
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.79
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.79
PRK10938 490 putative molybdenum transport ATP-binding protein 99.79
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.79
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.79
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.78
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.78
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.78
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.78
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.78
COG1123 539 ATPase components of various ABC-type transport sy 99.78
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.78
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.78
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.78
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.78
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.78
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.78
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.77
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.77
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.77
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.77
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.77
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.77
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.77
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.77
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.77
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.77
COG1123539 ATPase components of various ABC-type transport sy 99.77
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.76
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.76
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.76
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.76
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.76
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.76
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.76
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK10938490 putative molybdenum transport ATP-binding protein 99.76
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.76
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.76
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.75
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.75
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.75
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.75
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.75
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.75
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.75
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.74
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.74
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.74
PRK13409590 putative ATPase RIL; Provisional 99.74
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.74
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.74
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.74
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.74
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.74
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.74
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.74
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.74
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.74
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.73
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.73
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.73
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.73
PRK11147635 ABC transporter ATPase component; Reviewed 99.73
PLN03211 659 ABC transporter G-25; Provisional 99.73
COG4133209 CcmA ABC-type transport system involved in cytochr 99.72
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.72
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.72
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.72
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.72
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.72
PRK11147 635 ABC transporter ATPase component; Reviewed 99.72
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.72
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.72
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.72
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.71
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.71
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.71
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.71
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.71
COG4988559 CydD ABC-type transport system involved in cytochr 99.71
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.71
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.7
PLN03073718 ABC transporter F family; Provisional 99.7
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.7
PRK13409 590 putative ATPase RIL; Provisional 99.7
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.7
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.69
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.69
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.68
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.68
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.67
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.67
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.66
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.66
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.66
COG4987573 CydC ABC-type transport system involved in cytochr 99.66
COG0488 530 Uup ATPase components of ABC transporters with dup 99.66
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 99.66
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.65
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.65
COG4172534 ABC-type uncharacterized transport system, duplica 99.65
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.65
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.65
COG4172 534 ABC-type uncharacterized transport system, duplica 99.65
PLN032321495 ABC transporter C family member; Provisional 99.65
PLN03130 1622 ABC transporter C family member; Provisional 99.64
COG4136213 ABC-type uncharacterized transport system, ATPase 99.64
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.64
PLN03140 1470 ABC transporter G family member; Provisional 99.63
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.63
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.62
PLN03140 1470 ABC transporter G family member; Provisional 99.62
PTZ002431560 ABC transporter; Provisional 99.62
PLN03073 718 ABC transporter F family; Provisional 99.61
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.61
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.6
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.6
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.6
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.6
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.59
COG0488530 Uup ATPase components of ABC transporters with dup 99.59
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.58
PLN03130 1622 ABC transporter C family member; Provisional 99.57
PTZ00243 1560 ABC transporter; Provisional 99.56
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.56
PLN03232 1495 ABC transporter C family member; Provisional 99.54
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.5
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.47
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.45
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.39
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.39
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.39
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.37
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.36
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.36
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.35
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.35
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.33
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.33
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.31
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.29
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.29
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.28
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.26
KOG00541381 consensus Multidrug resistance-associated protein/ 99.25
COG4178604 ABC-type uncharacterized transport system, permeas 99.25
PRK09435332 membrane ATPase/protein kinase; Provisional 99.24
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.21
KOG0062 582 consensus ATPase component of ABC transporters wit 99.19
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.17
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.15
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.11
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.09
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.06
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.06
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.05
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.04
cd03239178 ABC_SMC_head The structural maintenance of chromos 98.99
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.99
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 98.99
COG4170330 SapD ABC-type antimicrobial peptide transport syst 98.97
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 98.96
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 98.96
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 98.93
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.92
cd03114148 ArgK-like The function of this protein family is u 98.89
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.88
KOG0062582 consensus ATPase component of ABC transporters wit 98.85
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.84
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.82
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.81
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 98.78
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 98.78
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 98.77
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 98.69
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.68
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.68
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.66
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.59
PRK13768253 GTPase; Provisional 98.59
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.59
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.58
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.58
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 98.52
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.41
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 98.39
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.36
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.35
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.34
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.33
PRK006351809 excinuclease ABC subunit A; Provisional 98.31
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.29
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.27
PHA02518211 ParA-like protein; Provisional 98.26
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.26
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.25
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 98.25
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.24
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.24
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.24
COG1159 298 Era GTPase [General function prediction only] 98.23
PRK15494 339 era GTPase Era; Provisional 98.22
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.21
PRK12337475 2-phosphoglycerate kinase; Provisional 98.21
cd00881189 GTP_translation_factor GTP translation factor fami 98.18
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.18
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.17
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.17
PRK00089 292 era GTPase Era; Reviewed 98.16
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.16
cd03112158 CobW_like The function of this protein family is u 98.15
PRK00409 782 recombination and DNA strand exchange inhibitor pr 98.15
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.14
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 98.14
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.14
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.09
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.09
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.08
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.08
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.07
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.07
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.06
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 98.06
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 98.04
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.04
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.04
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.03
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.03
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.02
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.02
PRK07721438 fliI flagellum-specific ATP synthase; Validated 97.98
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 97.98
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 97.98
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=3.4e-108  Score=866.00  Aligned_cols=568  Identities=50%  Similarity=0.794  Sum_probs=444.8

Q ss_pred             CcceEEEeecCcEEEeeccccCCCCCCChhHHHHHHhhhccccCCCceeecCCCCceeeeeEeecccceEEEEEeccccc
Q 007005            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (621)
Q Consensus         1 Mld~~~i~t~gG~vLw~~~~~~~~~~~~~in~li~~~~leer~~~~~~~~~~~~~~~~l~w~~~n~~~lvfv~vyq~~l~   80 (621)
                      |||+|.||||||+||||++.....+++ |||+||++||+|||++..+|.++    .|||||+++|+++||||+|||+|++
T Consensus         1 Mld~faIFtkgG~vLw~~~~~~~~~~~-~in~lI~~~ll~er~~~~~~~~~----~yTlk~q~~N~~~lvfvvvfqki~~   75 (587)
T KOG0781|consen    1 MLDQFAIFTKGGLVLWCYQEVGDNLKG-PINALIRSVLLSERGGVNSFTFE----AYTLKYQLDNQYSLVFVVVFQKILT   75 (587)
T ss_pred             CcceeeeecCCcEEEEEecccchhccc-hHHHHHHHHHHHhhcCcccCchh----heeEeeeecCCccEEEEEEEeccch
Confidence            999999999999999998877666777 99999999999999999999999    9999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcC--CCccchHHHHHHHHHHHHHHHHHh---hh-cccccCCCCcccccCCCCcCCCCcc
Q 007005           81 LLYVDDLLAMMKQSFSEIYDPKR--TDYSDFDEMFRQLRKEAEARAEEL---KK-SKQVTKPMNNLKKQGGQLQKGGFER  154 (621)
Q Consensus        81 l~y~d~ll~~~~~~f~~~y~~~~--~~~~~f~~~f~~~l~~~e~~~~~~---~~-~~~~~~~~~~~~~~~~~~~~~~~~~  154 (621)
                      |.|+|+||++++..|+..|.+..  ..+-+|.+.|..+|+.........   .+ +..+.   .++..++......... 
T Consensus        76 L~yv~~ll~~v~~~f~e~~~~~~~~~l~~n~~~~~~e~lk~rq~~ne~t~~k~~~pi~~~---~~~~~~K~~~~v~~~~-  151 (587)
T KOG0781|consen   76 LTYVDKLLNDVLNLFREKYDTQSALSLLNNTFDFQEELLKLRQVANEATEYKIRAPITMK---KSEDLEKAKDPVRSPI-  151 (587)
T ss_pred             hhhHHHHHHHHHHHHHHHhccchHHHhhhhhHHHHHHHHHHhhcccccchhhhcccchhh---hhhcchhhhhhhcccc-
Confidence            99999999999999999998633  334455666666666544321111   11 11111   1222222111100000 


Q ss_pred             CCCCCCCCCCCCCCCCCCcccccccCCCCCCCCcccccccccccCCCCCCCCCCccccchHHHHHhhccCCCCcccccCC
Q 007005          155 GSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSK  234 (621)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (621)
                             ..+.+..+.+..      +..+++.                .+...+      ..++++-+..++++   ...
T Consensus       152 -------e~~~d~s~kk~~------nt~kng~----------------~~~~h~------~~~kk~~~~tkkKg---~~s  193 (587)
T KOG0781|consen  152 -------ETNGDKSAKKKK------NTKKNGA----------------KKEGHD------EEFKKKHRETKKKG---NKS  193 (587)
T ss_pred             -------ccccccchhccc------ccccCCC----------------cccchh------hhhhhhhccccccc---ccC
Confidence                   000000000000      0111111                000000      11222211111110   011


Q ss_pred             CCCCCCCCccccCCccCCCCC--CCCCCccCCCCCCCCC----cchhhhhhcCCCCc-CcccccCCCCcchhhhhhcCCC
Q 007005          235 GSNPDPKKKITKKNRVWDDSP--PESKLDFTDPAGGNGS----NIEVEAADHGESMM-DKEEVFSSDSESEEDEEVGKHN  307 (621)
Q Consensus       235 ~~~~~~~~k~~k~~r~w~~~~--~~~~ld~s~~~~~~~~----~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  307 (621)
                      ++...|++|.+|++|+||+++  +.+.||||++..++++    .++......+.|.. +++-+.+++++++ +++ ..+.
T Consensus       194 ~~~~~p~kKGkk~~RvWdd~g~~d~~~ld~sss~sn~e~a~~e~vn~~~~~s~~~~~~~l~~~~~d~~~s~-~~~-~~~~  271 (587)
T KOG0781|consen  194 TKVDAPKKKGKKAPRVWDDAGCEDEKVLDYSSSTSNGENALSETVNLDQGESMGGQLQDLDKDSSDDEGSA-DNS-TDPA  271 (587)
T ss_pred             CCCCCchhhcccccchhhhccchhhcccccCCccccccchhHHHhhhhhhccccccccccccccccccccc-ccc-cchh
Confidence            122244566666699999876  5788999998886532    22222222222222 1111111111111 111 1112


Q ss_pred             CCCCcccchHHHHHHHhccCcccCccchHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHhcCCCCCCccchHHHHHHHHH
Q 007005          308 KPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAME  387 (621)
Q Consensus       308 ~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~l~~l~~~L~~~~V~~~ia~~L~~~v~~~l~g~~~~~~~~~~~~v~~al~  387 (621)
                      ...+..+||| +||++++|++.|.++||.|++++|++||+.+||++++|++||++|...|.|+++++|+++.++++++|+
T Consensus       272 ~~~k~~g~aF-g~fkglvG~K~L~eeDL~pvL~kM~ehLitKNVA~eiA~~LcEsV~a~Legkkv~sfs~V~~Tvk~Al~  350 (587)
T KOG0781|consen  272 ATKKTVGGAF-GLFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEGKKVGSFSTVESTVKEALR  350 (587)
T ss_pred             hhhcchhhHH-HHHHhhcccccccHhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHhhhcccccchHHHHHHHHHHH
Confidence            2344567777 499999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCccccccccccccccCCceEEEEEecCCCCHHHHHHHHHHhHhhcCcEEEEcccccceeeeeehhhhhhh
Q 007005          388 EALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHAR  467 (621)
Q Consensus       388 ~~L~~il~p~~~~~iL~dIs~~i~~Gep~iiaLVGpNGvGKTTlLakLAg~L~~~~GkV~I~~~Dt~RigaveQl~~~~~  467 (621)
                      ++|++||+|.+++|+|++|.-....++||+|+|||+|||||||+|+|||+||..++.+|+|++|||||.||||||++|.+
T Consensus       351 daLvQILTP~~sVDlLRdI~sar~~krPYVi~fvGVNGVGKSTNLAKIayWLlqNkfrVLIAACDTFRsGAvEQLrtHv~  430 (587)
T KOG0781|consen  351 DALVQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQNKFRVLIAACDTFRSGAVEQLRTHVE  430 (587)
T ss_pred             HHHHHHcCCCchhhHHHHHHHHHhcCCCeEEEEEeecCccccchHHHHHHHHHhCCceEEEEeccchhhhHHHHHHHHHH
Confidence            99999999999999999999888889999999999999999999999999999999999999999999999999999999


Q ss_pred             hc------ccceeecCCCCCHHHHHHHHHHHHhhcCCCccccccchhHHhHHHHHHHHHhhhhcCCCcEEEEEeCCcCCC
Q 007005          468 RL------QVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGN  541 (621)
Q Consensus       468 ~L------~v~l~~~~~~~d~~~ia~~al~~~~~~~~d~vliDtSGg~qqr~~LaraL~~l~~~~~PdlILLVDEpt~Gl  541 (621)
                      +|      .|++|+.+|++|++.++++|++++...++|++|+||+||||.+.+||++|.+++..+.||.||+|.|+++|.
T Consensus       431 rl~~l~~~~v~lfekGYgkd~a~vak~AI~~a~~~gfDVvLiDTAGR~~~~~~lm~~l~k~~~~~~pd~i~~vgealvg~  510 (587)
T KOG0781|consen  431 RLSALHGTMVELFEKGYGKDAAGVAKEAIQEARNQGFDVVLIDTAGRMHNNAPLMTSLAKLIKVNKPDLILFVGEALVGN  510 (587)
T ss_pred             HHHHhccchhHHHhhhcCCChHHHHHHHHHHHHhcCCCEEEEeccccccCChhHHHHHHHHHhcCCCceEEEehhhhhCc
Confidence            99      789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHhhcCCCCCCceEEEeccccccccchhHHHHhHHHhCCcEEEEecCCCCCcccCCCHHHHHHHhhC
Q 007005          542 DAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK  621 (621)
Q Consensus       542 D~~~q~~~f~~~L~~l~~~~~~~~it~IIlTK~De~~~~vG~~ls~~~~~g~PI~fvg~Gq~v~DL~~~~~~~~v~~Ll~  621 (621)
                      |+++|+..|+++|.+..   .++.||+|++||+|++++++|++++|+|.+|.||+|+|+||+|.||+.++++++|+.||+
T Consensus       511 dsv~q~~~fn~al~~~~---~~r~id~~~ltk~dtv~d~vg~~~~m~y~~~~pi~fvg~gqtysdlr~l~v~~vv~~lm~  587 (587)
T KOG0781|consen  511 DSVDQLKKFNRALADHS---TPRLIDGILLTKFDTVDDKVGAAVSMVYITGKPILFVGVGQTYSDLRKLNVKAVVATLMK  587 (587)
T ss_pred             HHHHHHHHHHHHHhcCC---CccccceEEEEeccchhhHHHHHhhheeecCCceEEEecCcchhhhhhccHHHHHHHhhC
Confidence            99999999999997765   578999999999999999999999999999999999999999999999999999999996



>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF04086 SRP-alpha_N: Signal recognition particle, alpha subunit, N-terminal; InterPro: IPR007222 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
3dmd_B328 Structures And Conformations In Solution Of The Sig 5e-54
3dm9_B328 Structures And Conformations In Solution Of The Sig 6e-53
2iy3_A 432 Structure Of The E. Coli Signal Recognition Particl 9e-25
1jpj_A296 Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 2e-24
1o87_A297 A New Mggdp Complex Of The Ffh Ng Domain Length = 2 2e-24
1ls1_A295 T. Aquaticus Ffh Ng Domain At 1.1a Resolution Lengt 3e-24
3ng1_A294 N And Gtpase Domains Of The Signal Sequence Recogni 3e-24
2ffh_A 425 The Signal Sequence Binding Protein Ffh From Thermu 5e-24
2c03_A297 Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 29 7e-24
1ffh_A294 N And Gtpase Domains Of The Signal Sequence Recogni 7e-24
2ng1_A293 N And Gtpase Domains Of The Signal Sequence Recogni 8e-24
1rj9_B300 Structure Of The Heterodimer Of The Conserved Gtpas 8e-24
3dm5_A 443 Structures Of Srp54 And Srp19, The Two Proteins Ass 1e-23
2xxa_A 433 The Crystal Structure Of The Signal Recognition Par 3e-22
2j37_W 504 Model Of Mammalian Srp Bound To 80s Rncs Length = 5 3e-22
2j28_9 430 Model Of E. Coli Srp Bound To 70s Rncs Length = 430 3e-22
2qy9_A309 Structure Of The Ng+1 Construct Of The E. Coli Srp 3e-21
2xxa_B302 The Crystal Structure Of The Signal Recognition Par 3e-21
2v3c_C 432 Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna C 3e-21
3ndb_B 454 Crystal Structure Of A Signal Sequence Bound To The 3e-21
1fts_A295 Signal Recognition Particle Receptor From E. Coli L 3e-21
2yhs_A503 Structure Of The E. Coli Srp Receptor Ftsy Length = 5e-21
4ak9_A318 Structure Of Chloroplast Ftsy From Physcomitrella P 6e-21
2og2_A359 Crystal Structure Of Chloroplast Ftsy From Arabidop 4e-20
2q9a_A304 Structure Of Apo Ftsy Length = 304 5e-20
1okk_D303 Homo-Heterodimeric Complex Of The Srp Gtpases Lengt 5e-20
2cnw_D284 Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Len 5e-20
2j7p_D283 Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpa 5e-20
3b9q_A302 The Crystal Structure Of Cpftsy From Arabidopsis Th 9e-20
1rj9_A304 Structure Of The Heterodimer Of The Conserved Gtpas 6e-19
3kl4_A 433 Recognition Of A Signal Peptide By The Signal Recog 1e-18
1qzw_A 440 Crystal Structure Of The Complete Core Of Archaeal 1e-18
1zu4_A320 Crystal Structure Of Ftsy From Mycoplasma Mycoides- 2e-17
1j8m_F297 Signal Recognition Particle Conserved Gtpase Domain 7e-17
1j8y_F297 Signal Recognition Particle Conserved Gtpase Domain 8e-17
1vma_A306 Crystal Structure Of Cell Division Protein Ftsy (Tm 3e-14
2fh5_A185 The Structure Of The Mammalian Srp Receptor Length 6e-14
2px0_A296 Crystal Structure Of Flhf Complexed With GmppnpMG(2 2e-06
>pdb|3DMD|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure

Iteration: 1

Score = 209 bits (531), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 117/275 (42%), Positives = 166/275 (60%), Gaps = 14/275 (5%) Query: 334 DLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRI 393 D++ AL L+ L+ +VA E+ + L E + L GKK+ T I++ A++EA+ I Sbjct: 51 DVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEI 110 Query: 394 LTPRRSIDILRDVHAAKEQRKPYXXXXXXXXXXXKSTNLAKVAYWLLQHKVSVMMAACDT 453 L R ID++ ++ A+ KPY K+T +AK+A WL H SV++AA DT Sbjct: 111 LETSRRIDLIEEIRKAE---KPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT 167 Query: 454 FRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNE 513 FR+GA+EQL HA+R+ V + + Y DPA VA +AIQ A G DVVL+DTAGR + N Sbjct: 168 FRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNR 227 Query: 514 PLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTK 573 LM + K+ + P+LV+FVG+AL GN V+Q +FN+ + IDGI+LTK Sbjct: 228 NLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVK----------IDGIILTK 277 Query: 574 FDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLK 608 D D + GAALS+ YV AP++FVG GQ Y DL+ Sbjct: 278 LDA-DARGGAALSISYVIDAPILFVGVGQGYDDLR 311
>pdb|3DM9|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure
>pdb|2IY3|A Chain A, Structure Of The E. Coli Signal Recognition Particle Bound To A Translating Ribosome Length = 432 Back     alignment and structure
>pdb|1JPJ|A Chain A, Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 Back     alignment and structure
>pdb|1O87|A Chain A, A New Mggdp Complex Of The Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|1LS1|A Chain A, T. Aquaticus Ffh Ng Domain At 1.1a Resolution Length = 295 Back     alignment and structure
>pdb|3NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|2FFH|A Chain A, The Signal Sequence Binding Protein Ffh From Thermus Aquaticus Length = 425 Back     alignment and structure
>pdb|2C03|A Chain A, Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|1FFH|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|2NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 293 Back     alignment and structure
>pdb|1RJ9|B Chain B, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 300 Back     alignment and structure
>pdb|3DM5|A Chain A, Structures Of Srp54 And Srp19, The Two Proteins Assembling The Ribonucleic Core Of The Signal Recognition Particle From The Archaeon Pyrococcus Furiosus. Length = 443 Back     alignment and structure
>pdb|2XXA|A Chain A, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 433 Back     alignment and structure
>pdb|2J37|W Chain W, Model Of Mammalian Srp Bound To 80s Rncs Length = 504 Back     alignment and structure
>pdb|2J28|9 Chain 9, Model Of E. Coli Srp Bound To 70s Rncs Length = 430 Back     alignment and structure
>pdb|2QY9|A Chain A, Structure Of The Ng+1 Construct Of The E. Coli Srp Receptor Ftsy Length = 309 Back     alignment and structure
>pdb|2XXA|B Chain B, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 302 Back     alignment and structure
>pdb|2V3C|C Chain C, Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna Complex Of M. Jannaschii Length = 432 Back     alignment and structure
>pdb|3NDB|B Chain B, Crystal Structure Of A Signal Sequence Bound To The Signal Recognition Particle Length = 454 Back     alignment and structure
>pdb|1FTS|A Chain A, Signal Recognition Particle Receptor From E. Coli Length = 295 Back     alignment and structure
>pdb|2YHS|A Chain A, Structure Of The E. Coli Srp Receptor Ftsy Length = 503 Back     alignment and structure
>pdb|4AK9|A Chain A, Structure Of Chloroplast Ftsy From Physcomitrella Patens Length = 318 Back     alignment and structure
>pdb|2OG2|A Chain A, Crystal Structure Of Chloroplast Ftsy From Arabidopsis Thaliana Length = 359 Back     alignment and structure
>pdb|2Q9A|A Chain A, Structure Of Apo Ftsy Length = 304 Back     alignment and structure
>pdb|1OKK|D Chain D, Homo-Heterodimeric Complex Of The Srp Gtpases Length = 303 Back     alignment and structure
>pdb|2CNW|D Chain D, Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Length = 284 Back     alignment and structure
>pdb|2J7P|D Chain D, Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpases Ffh And Ftsy Length = 283 Back     alignment and structure
>pdb|3B9Q|A Chain A, The Crystal Structure Of Cpftsy From Arabidopsis Thaliana Length = 302 Back     alignment and structure
>pdb|1RJ9|A Chain A, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 304 Back     alignment and structure
>pdb|3KL4|A Chain A, Recognition Of A Signal Peptide By The Signal Recognition Particle Length = 433 Back     alignment and structure
>pdb|1QZW|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication Length = 440 Back     alignment and structure
>pdb|1ZU4|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group P21212 Length = 320 Back     alignment and structure
>pdb|1J8M|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens Length = 297 Back     alignment and structure
>pdb|1J8Y|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens T112a Mutant Length = 297 Back     alignment and structure
>pdb|1VMA|A Chain A, Crystal Structure Of Cell Division Protein Ftsy (Tm0570) From Thermotoga Maritima At 1.60 A Resolution Length = 306 Back     alignment and structure
>pdb|2FH5|A Chain A, The Structure Of The Mammalian Srp Receptor Length = 185 Back     alignment and structure
>pdb|2PX0|A Chain A, Crystal Structure Of Flhf Complexed With GmppnpMG(2+) Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 1e-102
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 1e-55
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 3e-55
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 9e-55
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 6e-53
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 8e-52
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 5e-51
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 6e-51
2og2_A359 Putative signal recognition particle receptor; nuc 5e-48
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 6e-48
2xxa_A 433 Signal recognition particle protein; protein trans 9e-48
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 2e-47
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 5e-45
1vma_A306 Cell division protein FTSY; TM0570, structural gen 3e-44
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 2e-43
2fh5_A185 Signal recognition particle receptor alpha subunit 5e-42
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 1e-41
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 9e-05
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 2e-04
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328 Back     alignment and structure
 Score =  312 bits (801), Expect = e-102
 Identities = 134/342 (39%), Positives = 195/342 (57%), Gaps = 20/342 (5%)

Query: 280 HGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPAL 339
           H  SM  K            +EEV K  + + +K G    +      +      D++ AL
Sbjct: 3   HMASMFGKLREKLKSFVKRVEEEVEK-EEEEVEKKGLLDRILTVEIKEK-----DVDKAL 56

Query: 340 KALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRS 399
             L+  L+  +VA E+ + L E +   L GKK+   T    I++ A++EA+  IL   R 
Sbjct: 57  DELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRR 116

Query: 400 IDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAV 459
           ID++ ++  A+   KPYV++FVG NG GK+T +AK+A WL  H  SV++AA DTFR+GA+
Sbjct: 117 IDLIEEIRKAE---KPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAI 173

Query: 460 EQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRAL 519
           EQL  HA+R+ V + +  Y  DPA VA +AIQ A   G DVVL+DTAGR + N  LM  +
Sbjct: 174 EQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEM 233

Query: 520 SKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDD 579
            K+  +  P+LV+FVG+AL GN  V+Q  +FN+ +           IDGI+LTK D  D 
Sbjct: 234 KKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVK----------IDGIILTKLDA-DA 282

Query: 580 KVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK 621
           + GAALS+ YV  AP++FVG GQ Y DL+    +  ++ +  
Sbjct: 283 RGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG 324


>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Length = 296 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Length = 297 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Length = 443 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Length = 433 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Length = 432 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Length = 295 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Length = 425 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Length = 433 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320 Back     alignment and structure
>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1 Length = 185 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Length = 304 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query621
2fh5_A185 Signal recognition particle receptor alpha subunit 100.0
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 100.0
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 100.0
2og2_A359 Putative signal recognition particle receptor; nuc 100.0
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 100.0
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 100.0
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 100.0
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 100.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 100.0
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 100.0
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 100.0
1vma_A306 Cell division protein FTSY; TM0570, structural gen 100.0
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 100.0
2xxa_A 433 Signal recognition particle protein; protein trans 100.0
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 100.0
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 99.97
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.97
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.9
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.9
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.9
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.9
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.9
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.89
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.89
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.89
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.89
1g6h_A257 High-affinity branched-chain amino acid transport 99.89
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.89
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.89
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.89
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.88
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.88
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.88
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.88
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.88
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.88
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.88
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.88
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.88
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.88
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.87
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.86
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.86
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.85
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.85
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.85
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.85
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.84
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.84
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.84
2ghi_A260 Transport protein; multidrug resistance protein, M 99.84
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.83
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.83
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.8
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.79
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.78
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.78
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.78
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.77
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.77
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.75
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.74
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.72
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.72
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.7
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.7
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.69
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.68
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.67
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.67
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.67
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.66
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.65
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.64
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.6
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.57
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.54
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.52
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.52
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.45
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.45
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.43
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.4
2vx8_A169 Nucleoporin-like protein RIP, vesicle-associated m 99.36
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.36
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.34
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.32
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.32
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.28
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.25
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.25
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.24
1e69_A322 Chromosome segregation SMC protein; structural mai 99.13
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.12
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.12
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.11
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.07
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.04
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.03
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.02
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.01
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 99.01
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.01
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.0
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.98
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.97
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.96
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.96
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.95
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.94
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.93
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.92
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.89
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 98.88
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.86
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.85
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.8
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.8
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.79
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.77
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.77
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.75
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.73
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.73
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.71
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.63
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.61
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.6
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.6
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.59
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.54
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.52
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.5
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.47
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.46
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.44
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.36
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.35
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 98.32
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.32
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.31
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.3
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.3
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.26
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.25
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.23
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.21
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.2
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.2
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.18
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.15
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.15
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.13
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.12
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.12
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.11
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.1
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.1
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.1
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.09
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.09
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.08
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.08
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.07
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.06
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.06
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.06
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.04
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.04
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.04
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 98.04
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.04
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.04
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.04
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 98.02
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.02
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.02
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.01
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.01
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.0
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.0
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.0
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.0
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.0
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.99
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 97.98
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 97.98
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.98
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.98
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.97
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.96
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.95
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.95
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.95
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.94
1p9r_A418 General secretion pathway protein E; bacterial typ 97.94
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.94
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.94
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.94
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 97.94
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.94
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.93
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.93
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 97.92
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.91
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.91
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.9
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 97.9
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 97.9
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.89
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.88
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.88
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 97.88
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.88
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 97.87
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.87
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.87
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.87
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.87
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 97.87
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.86
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.86
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.86
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.85
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.85
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.85
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.85
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.84
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.84
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.83
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.83
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.83
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.83
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.83
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.82
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 97.82
2ged_A193 SR-beta, signal recognition particle receptor beta 97.82
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.81
3end_A307 Light-independent protochlorophyllide reductase ir 97.81
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.81
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.81
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 97.81
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.81
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.8
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.8
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.79
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.79
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.79
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.79
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.79
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 97.79
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.78
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.77
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 97.77
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.77
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.76
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.76
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.75
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.75
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.73
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.73
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.72
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.71
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.71
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.71
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 97.71
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.7
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.7
3kta_A182 Chromosome segregation protein SMC; structural mai 97.69
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.68
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 97.68
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 97.68
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.68
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.67
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 97.67
1nrj_A158 Signal recognition particle receptor alpha subunit 97.67
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.67
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.65
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.65
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.64
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.64
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 97.64
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.63
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 97.63
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 97.62
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.61
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 97.6
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.6
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.59
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.59
3cwq_A209 Para family chromosome partitioning protein; alpha 97.57
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 97.57
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.56
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 97.56
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 97.56
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.56
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.55
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 97.55
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.55
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 97.55
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.55
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.55
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 97.54
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.54
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 97.54
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 97.54
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.53
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.52
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 97.52
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.51
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.51
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.51
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.5
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.48
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.46
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.46
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.45
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.45
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.44
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.44
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.43
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.42
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.42
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 97.42
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.41
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.41
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 97.41
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.41
3kta_B173 Chromosome segregation protein SMC; structural mai 97.41
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.4
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.4
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 97.39
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 97.39
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.39
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.39
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.39
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.38
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.38
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.37
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.37
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.37
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.36
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.35
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.34
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.33
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 97.33
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.43
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.31
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.3
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.28
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.27
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.25
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.25
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.24
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.24
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 97.22
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.21
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 97.21
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.2
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.19
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.18
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 97.17
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.17
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.17
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.17
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 97.15
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.15
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.15
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.14
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.13
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.13
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.12
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.1
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 97.1
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 97.09
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.09
2z43_A324 DNA repair and recombination protein RADA; archaea 97.08
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.07
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.07
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.06
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.06
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.06
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.05
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 97.05
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.04
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.04
4afi_A173 AP-3 complex subunit delta-1, vesicle-associated p 97.03
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.02
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.01
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.01
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.99
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 96.99
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 96.96
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 96.96
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 96.95
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.93
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.93
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.91
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.9
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.9
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.9
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 96.88
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.88
3llu_A196 RAS-related GTP-binding protein C; structural geno 96.88
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.86
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 96.85
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 96.85
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.84
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 96.83
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 96.83
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.81
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 96.8
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.8
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 96.78
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 96.78
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 96.77
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.77
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.75
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 96.74
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.73
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.72
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.7
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.69
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 96.69
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.69
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.67
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 96.65
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.65
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 96.63
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 96.61
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 96.61
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 96.6
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 96.6
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.57
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.55
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 96.54
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.53
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.51
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.5
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.46
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.44
3io5_A333 Recombination and repair protein; storage dimer, i 96.44
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.43
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 96.42
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 96.42
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 96.41
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.35
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.35
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.34
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.28
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.28
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.28
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.25
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.25
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 96.22
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.22
3bos_A242 Putative DNA replication factor; P-loop containing 96.2
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.19
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.18
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 96.17
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.17
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.08
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.06
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.04
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.03
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 96.03
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.0
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.0
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.99
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.98
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.93
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.93
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.9
3igf_A 374 ALL4481 protein; two-domained protein consisting o 95.9
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 95.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.89
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.86
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.85
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.83
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.83
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.82
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.81
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.8
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.78
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.77
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.77
3ice_A422 Transcription termination factor RHO; transcriptio 95.76
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.76
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.74
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 95.7
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.67
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.66
1via_A175 Shikimate kinase; structural genomics, transferase 95.65
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.63
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 95.62
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.6
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.59
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.58
>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1 Back     alignment and structure
Probab=100.00  E-value=3.4e-43  Score=338.38  Aligned_cols=143  Identities=32%  Similarity=0.525  Sum_probs=103.7

Q ss_pred             CcceEEEeecCcEEEeeccccCCCCCCChhHHHHHHhhhccccCCCceeecCCCCceeeeeEeecccceEEEEEeccccc
Q 007005            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (621)
Q Consensus         1 Mld~~~i~t~gG~vLw~~~~~~~~~~~~~in~li~~~~leer~~~~~~~~~~~~~~~~l~w~~~n~~~lvfv~vyq~~l~   80 (621)
                      |.|+|+|||||||||||++ ++++++++|||+||++||||||+++++|.+|    +|+|||+|+||||||||||||+|||
T Consensus        10 ~~D~~~IfTkGGvVLWs~~-~~~~~~~~~IN~LIr~VlLEER~~~~~y~~d----~ytlkW~l~NEl~LVFVvVYQ~iL~   84 (185)
T 2fh5_A           10 MVDFFTIFSKGGLVLWCFQ-GVSDSCTGPVNALIRSVLLQERGGNNSFTHE----ALTLKYKLDNQFELVFVVGFQKILT   84 (185)
T ss_dssp             SCSEEEEEETTSBEEEEEB-TTTBSCCCHHHHHHHHTGGGC-------CCC----CCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             ceeEEEEEeCCeEEEEeec-CCcccccchHHHHHHHhhhccccCCCceeEc----CeEEEEEEeccCCEEEEEEEccccc
Confidence            8999999999999999953 4456899999999999999999999999999    9999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcCC---------CccchHHHHHHHHHHHHHHHHHhhhcccccCCCCcccccCCCCcCCC
Q 007005           81 LLYVDDLLAMMKQSFSEIYDPKRT---------DYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGG  151 (621)
Q Consensus        81 l~y~d~ll~~~~~~f~~~y~~~~~---------~~~~f~~~f~~~l~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  151 (621)
                      |+|||+||++|++.|+++|++.+.         .+.+||++|+++|+++|..++.++ ++.|+   +|++++++++...+
T Consensus        85 L~YiD~LL~~v~~~Fv~~Y~~~L~~~~~~~~~~~~~~Fd~~F~~~l~~~e~~~~~~~-~k~mr---~fees~ks~k~~~~  160 (185)
T 2fh5_A           85 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRA-PTTMK---KFEDSEKAKKPVRS  160 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCCCCHHHHHHHHHHHHHHTC--------------------------
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhhcccccccccccCchhHHHHHHHHHHHHHHHhhh-HHhhc---cHhhhhhhhhhhhh
Confidence            999999999999999999977632         233799999999999998876544 55564   68888887764334


Q ss_pred             C
Q 007005          152 F  152 (621)
Q Consensus       152 ~  152 (621)
                      +
T Consensus       161 ~  161 (185)
T 2fh5_A          161 M  161 (185)
T ss_dssp             -
T ss_pred             h
Confidence            3



>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2vx8_A Nucleoporin-like protein RIP, vesicle-associated membrane protein 7; endocytosis,exocytosis, endocytosis, exocytosis, acetylation, coiled coil; 2.2A {Homo sapiens} PDB: 2dmw_A Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1nrj_A Signal recognition particle receptor alpha subunit homolog; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: d.110.4.4 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4afi_A AP-3 complex subunit delta-1, vesicle-associated protein 7; endocytosis, exocytosis, clathrin adaptor, chimera, fusion P; 2.80A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 621
d2qy9a2211 c.37.1.10 (A:285-495) GTPase domain of the signal 4e-47
d1vmaa2213 c.37.1.10 (A:82-294) GTPase domain of the signal r 2e-45
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 1e-44
d2fh5a1129 d.110.4.4 (A:1-129) Signal recognition particle re 2e-44
d1j8yf2211 c.37.1.10 (F:87-297) GTPase domain of the signal s 9e-42
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 1e-40
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 9e-24
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 7e-22
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 7e-11
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 6e-10
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 2e-05
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 5e-05
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal recognition particle receptor FtsY
species: Escherichia coli [TaxId: 562]
 Score =  162 bits (412), Expect = 4e-47
 Identities = 71/210 (33%), Positives = 107/210 (50%), Gaps = 5/210 (2%)

Query: 411 EQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQ 470
           E + P+V++ VGVNGVGK+T + K+A    Q   SVM+AA DTFR+ AVEQL+   +R  
Sbjct: 5   EGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNN 64

Query: 471 VPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDL 530
           +P+  +    D A V  +AIQ A     DV++ DTAGR+Q+   LM  L K++ +     
Sbjct: 65  IPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLD 124

Query: 531 VLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYV 590
           V    E ++  DA    +  +Q      +      + GI LTK D    K G   S+   
Sbjct: 125 VEAPHEVMLTIDASTGQNAVSQAKLFHEAVG----LTGITLTKLDG-TAKGGVIFSVADQ 179

Query: 591 SGAPVMFVGCGQSYTDLKKLNVKSIVKTLL 620
            G P+ ++G G+   DL+       ++ L 
Sbjct: 180 FGIPIRYIGVGERIEDLRPFKADDFIEALF 209


>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query621
d2fh5a1129 Signal recognition particle receptor alpha subunit 100.0
d2qy9a2211 GTPase domain of the signal recognition particle r 100.0
d1vmaa2213 GTPase domain of the signal recognition particle r 100.0
d1okkd2207 GTPase domain of the signal recognition particle r 100.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 100.0
d1ls1a2207 GTPase domain of the signal sequence recognition p 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.94
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.94
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.93
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.93
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.93
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.91
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.91
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.91
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.91
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.88
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.87
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.87
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.87
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.86
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.86
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.85
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.84
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.98
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.97
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.9
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.79
d1ls1a188 Signal sequence recognition protein Ffh {Thermus a 98.52
d1j8yf184 Signal sequence recognition protein Ffh {Archaeon 98.47
d1wgwa_99 Signal recognition particle 54 kDa protein, SRP54 98.41
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.35
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.27
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.2
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.11
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.09
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.03
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.0
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.98
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.91
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.89
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.86
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.83
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.82
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.81
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.8
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 97.78
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.76
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.73
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.71
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.71
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.68
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 97.64
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.62
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.6
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 97.54
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.53
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.52
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.52
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.51
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.5
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.5
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.48
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.46
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.43
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 97.4
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.32
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.3
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.29
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.28
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.28
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.27
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.23
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.23
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.22
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.21
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.18
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.17
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.16
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.14
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.13
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 97.1
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.08
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.06
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.05
d2qy9a184 Signal recognition particle receptor, FtsY {Escher 97.05
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.03
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.99
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.96
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.96
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.95
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.95
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.93
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.91
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.9
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.89
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.88
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.83
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.78
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.77
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.73
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1nrja_155 Srx domain of the signal recognition particle rece 96.71
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.71
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.7
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.69
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.68
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.66
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.61
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.59
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.57
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.55
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.51
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.5
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.47
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.44
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.4
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.4
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.39
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.37
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.35
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.3
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.28
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.22
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.19
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.18
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.13
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.12
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.1
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.09
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.08
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.07
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.06
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.02
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.98
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.95
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.94
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.93
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.92
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.92
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.87
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.85
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.84
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.83
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.81
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.78
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.76
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.76
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.74
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.71
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.7
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.7
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.67
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.66
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.65
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.63
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.63
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.58
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.56
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 95.55
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.54
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.53
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.51
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.51
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.45
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.45
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.4
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.39
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.29
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.28
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.19
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.09
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.07
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.01
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.95
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 94.86
d1okkd158 Signal recognition particle receptor, FtsY {Thermu 94.84
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.83
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.77
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.73
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.51
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.5
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.46
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.27
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.22
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.18
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.16
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.13
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.03
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.03
d2vglm2141 Mu2 adaptin (clathrin coat assembly protein AP50) 93.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.85
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.74
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.71
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.7
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.64
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.64
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.58
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.5
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.46
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.38
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.37
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.29
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.21
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.16
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.11
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.94
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.87
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.59
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.49
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.4
d1svma_362 Papillomavirus large T antigen helicase domain {Si 92.26
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.22
d1vmaa181 Signal recognition particle receptor, FtsY {Thermo 92.16
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.0
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.95
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.87
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.63
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.58
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.35
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.31
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.25
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.21
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.99
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.66
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 90.6
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.5
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 90.21
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.17
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 89.99
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.52
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 89.49
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.4
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 89.36
d1xpua3289 Transcription termination factor Rho, ATPase domai 89.34
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 89.02
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.01
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.77
d1ifqa_127 Sec22b {Mouse (Mus musculus) [TaxId: 10090]} 88.56
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 88.48
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 87.64
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.46
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.42
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.26
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 86.7
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.48
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 86.38
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.94
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.75
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 85.71
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 85.58
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 84.72
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.7
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 83.97
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 83.39
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 82.95
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 82.37
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 82.2
d2vgls_142 Sigma2 adaptin (clathrin coat assembly protein AP1 80.96
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 80.36
>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: SNARE-like
family: SRP alpha N-terminal domain-like
domain: Signal recognition particle receptor alpha subunit, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-42  Score=315.27  Aligned_cols=118  Identities=39%  Similarity=0.704  Sum_probs=102.4

Q ss_pred             CcceEEEeecCcEEEeeccccCCCCCCChhHHHHHHhhhccccCCCceeecCCCCceeeeeEeecccceEEEEEeccccc
Q 007005            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (621)
Q Consensus         1 Mld~~~i~t~gG~vLw~~~~~~~~~~~~~in~li~~~~leer~~~~~~~~~~~~~~~~l~w~~~n~~~lvfv~vyq~~l~   80 (621)
                      |||+|+|||||||||||++.. ++.+++|||+||++||||||+++++|.||    +|+|||+++||++||||||||++||
T Consensus         1 MiD~f~IftkGGiVLW~~~~~-~~~~~~~IN~LI~~vlLEER~~~~~~~~d----~y~lkw~~~Ne~~lvfV~vYQ~il~   75 (129)
T d2fh5a1           1 MVDFFTIFSKGGLVLWCFQGV-SDSCTGPVNALIRSVLLQERGGNNSFTHE----ALTLKYKLDNQFELVFVVGFQKILT   75 (129)
T ss_dssp             SCSEEEEEETTSBEEEEEBTT-TBSCCCHHHHHHHHTGGGC-------CCC----CCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             CccEEEEEeCCeEEEEeecCC-CcccchhHHHHHHHhheecccCCCceeEC----CEEEEEEEeccCCEEEEEEEhhhhc
Confidence            999999999999999995433 47899999999999999999999999999    9999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcC----------CCccchHHHHHHHHHHHHHHH
Q 007005           81 LLYVDDLLAMMKQSFSEIYDPKR----------TDYSDFDEMFRQLRKEAEARA  124 (621)
Q Consensus        81 l~y~d~ll~~~~~~f~~~y~~~~----------~~~~~f~~~f~~~l~~~e~~~  124 (621)
                      |+|+|+||++|++.|+++|++.+          ..| +||++|+++|+++|+++
T Consensus        76 l~yvd~lL~~i~~~F~~~y~~~l~~~~~~~~~~~~~-~Fd~~F~~~l~~~e~~~  128 (129)
T d2fh5a1          76 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTF-DFQNDFLRLLREAEESS  128 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCC-CCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhccccccccccccc-chHHHHHHHHHHHHHhc
Confidence            99999999999999999998754          234 89999999999999764



>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a1 a.24.13.1 (A:201-284) Signal recognition particle receptor, FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure