Citrus Sinensis ID: 007005


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
cccEEEEEccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccCEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccEEEEEHHHccccEEEEEccccccccccccHHHHHHHHcc
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRK*****************************************************************************************************************************************************************************************************WFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQDNEPLMRALSKLIYLNNPDLVLFVGEALVGNDAVDQLSKFNQKLADLSSSPNPQLIDGILLTKFDTIDDKVGAALSMVYVSGAPVMFVGCGQSYTDLKKLNVKSIVKTLLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle receptor subunit alpha Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.probableQ9DBG7
Signal recognition particle receptor subunit alpha Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.probableP08240
Signal recognition particle receptor subunit alpha homolog Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system (By similarity). May have a role in axonogenesis.probableQ9U5L1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J8M, chain F
Confidence level:very confident
Coverage over the Query: 314-552,563-620
View the alignment between query and template
View the model in PyMOL
Template: 2FH5, chain A
Confidence level:very confident
Coverage over the Query: 1-125
View the alignment between query and template
View the model in PyMOL