Citrus Sinensis ID: 007040


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620
MMKNRFPAAMPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTKSDGRRSRSGKKAKKRHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQASSRCASPEELRSRKTPIESIQESTSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLVFFFFYFFPKIL
ccccccccccccccccccccEEEEEcccccccccccccccEEEECcccccccHHHHHccccEEEEcccccccHHHHHcccccEEEEEEcccccHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHccccEEEEEcccccccccccccccEEcccHHHHHHHccEEEECccccccccccccHHHHHccccccEEEEccccccccHHHHHHHHHcccEEEEEcccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccHHHHHcccccccccccccccccEEEEEEEEccccEEEEEEECccccEEEEEEcccccccccccEEEEEcccccccccccccccEEEEccEEEEEEEEcccccccccEEcccccccEEEccccccEEEEEEEEEccc
********************SVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQ*****************************************************************************************************************************ETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLVFFFFYFFPKIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKNRFPAAMPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTKSDGRRSRSGKKAKKRHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQASSRCASPEELRSRKTPIESIQESTSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLVFFFFYFFPKIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
C-terminal binding protein AN Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex (By similarity). Required for cortical microtubules (MTs) arrangement that confers cell shape. Regulates the width of leaves by controlling the polar elongation of leaf cells. Involved in the regulation of trichome branching. Seems to not be able to regulate gene transcription. Regulates epidermal cell divisions and elongation in a non-cell-autonomous manner (regulated by subepidermal cells), but regulates epidermal cell polarity, shape, trichome branching and elongation in a cell-autonomous manner.confidentO23702

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MX3, chain A
Confidence level:very confident
Coverage over the Query: 19-337
View the alignment between query and template
View the model in PyMOL
Template: 3DDN, chain A
Confidence level:probable
Coverage over the Query: 162-377
View the alignment between query and template
View the model in PyMOL