Citrus Sinensis ID: 007087

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62

MSEVSGDGGAAAPEWNGSTGVTATPAPPPLMSSASFKEGGGGRSSSRRRPVRPSFDADNEFMTLLHGSDPVKVELNRLENEVRDKDRELGEAQAEIKALRLSERLREKAVEELTEELSKVEEKLKLAENLIETKNLEIKKINDEKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEIAKLQDDNKALDRLTKSKEAALLEAERTVQVALAKASMVDDLQNKNQELMKQIEICQEENKILDKMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKVQEMNEERKTLDRELARAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQGEMQQLRDRLAITERTAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNISKLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTRSLDRSKVLLNGSPNQSIDATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEILAKKVDTLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDHENRAKRFGNTKGPVSSAQLLPGRNVPRSGLTRSTQ

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHcccccccHHHccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc

********************************************************************************************************************************************************************************ILAPL**************************************VQVALA*****************QIEICQEENKILD******VAEVEKLTQTVRELEEAVLAGGAAANAV**********************RAKVTANRVATVVANEWKDANDKVMPVKQWLEERRFLQG****************************************************************************************************************************************************************GVLYDLLQKEVVAL*******************ILA************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSEVSGDGGAAAPEWNGSTGVTATPAPPPLMSSASFKEGGGGRSSSRRRPVRPSFDADNEFMTLLHGSDPVKVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRASMAAQFAAEATLRRVHAAQKDDDMPPIEAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxTKSKEAALLEAERTVQVALAKASMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLAGGAAANAxxxxxxxxxxxxxxxxxxxxxxxxxxxxANRVATVVANEWKDANDKVMPxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKSEAQLKEKYHLRLKVLEESLRGSSNGSGRSTSDGRSISNGSSRRQSLGGADNISKLTSNGFISKRTPSSRSLSSSTVLKHAKGTSKSFDGGTRSLDRSKVLLNGSPNQSIDATKDSDTPNTWKGNLEDKPSEFQSTDTEDSVPGVLYDLLQKEVVALRKAGHEKDQSLKDKDDAIEILAKKVDTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDHENRAKRFGNTKGPVSSAQLLPGRNVPRSGLTRSTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Microtubule-associated protein 70-1	Plant-specific protein that interact with microtubules. In association with MAP70.5, is essential for the normal banding pattern of secondary cell wall and for the proper development of xylem tracheary elements and wood formation.	confident	Q9C9X0
Microtubule-associated protein 70-2	Plant-specific protein that interact with microtubules.	confident	Q6Z746
Microtubule-associated protein 70-1	Plant-specific protein that interact with microtubules.	probable	Q2QLI6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 188-217,228-257
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 342-379
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 87-127
View the alignment between query and template
View the model in PyMOL

Template: 1F5N, chain A
Confidence level:probable
Coverage over the Query: 222-309
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1g8x, chain A		probable	Alignment \| Template Structure