Citrus Sinensis ID: 007089

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62
MYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLTGKYAASYVRGLQGNTGSRLKVAACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNGKPTCADPDILKNTIHGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEEAAADAIKAAIHTEGAVRGGLLREEDVNLALAYTITVQMRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccEEEEcccccccccccccccccccccccccHHHHHHHcccHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHcccccccEEEcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcEEEEEccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHccEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEccccccccccccccccccccccccccccccEEccccccccccEEEEEEEEEcccccccEEEEEEEEccccccccccEEccccEEEEccccEEEEEEEEcccccEEEEcccccEEEcccCEEEEEccccccEEEEEEEEEEEc
*YNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLTGKYAASYVRGLQGNTGSRLKVAACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNGKPTCADPDILKNTIHGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEEAAADAIKAAIHTEGAVRGGLLREEDVNLALAYTITVQMRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLTGKYAASYVRGLQGNTGSRLKVAACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNGKPTCADPDILKNTIHGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEEAAADAIKAAIHTEGAVRGGLLREEDVNLALAYTITVQMRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-D-xylosidase 1 Involved in pectic arabinan modification in mucilage secretory cells. Acts also as a beta-D-xylosidase during the remodeling of xylans in vascular development.probableQ9FGY1
Putative beta-D-xylosidase (Fragment) May be involved in cell wall metabolism, related to senescence.probableP83344

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.37Xylan 1,4-beta-xylosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ABZ, chain A
Confidence level:very confident
Coverage over the Query: 8-153,168-482,515-613
View the alignment between query and template
View the model in PyMOL
Template: 3RRX, chain A
Confidence level:very confident
Coverage over the Query: 8-305,321-478
View the alignment between query and template
View the model in PyMOL
Template: 3ZYZ, chain A
Confidence level:very confident
Coverage over the Query: 8-153,168-491,502-614
View the alignment between query and template
View the model in PyMOL
Template: 4I8D, chain A
Confidence level:confident
Coverage over the Query: 20-220,231-509,523-614
View the alignment between query and template
View the model in PyMOL