Citrus Sinensis ID: 007097

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62

MVPRVLEWGDGYYNGDIKTRKTMQAMELTPDKIGLQRSKQLRELYESLLKGESELAYKRPSAALSPEDLTDAEWYYLVCMSFVFSSGQGLPGRALANSETIWLCNAQCADSKVFSRSLLAKSASIQTVICFPHLDGVIELGVTELVPEDPSLLQHIKASLLDFSKPFCSEKSSSPPYDEDDDSDPLCAKVSHEILDTVALESLYSPGEENKFDGEGVYELHGNINEELHLDSADECSKGCEHNHQTEESFMVDGINGAASQVQSWHFVDDDLSNGIPDSMHSSDHKSESLVNQAEGFPSSKDENMSHIQLKELQEGNHTKLSLLDLGIVDGAHYRKTLSAIFGSSNRLTENPCFLSVEHKSSFVSWKKGGMVKRHWPGIQQNLLKKILFSVPLMHGGCTHRSQKEICRKYCPVTMESDNFCEEHISSDKRTENEKFMVLRSMVPYISEVDKASILSDTIKYLKKLEARVEELESCMYSVDSEPRPKRNYTEMVEQTSDNYDNKKLDNHKKPWINKRKACDIDETDPELNKFVPKDGLADVKVSIQEMDVLIEMRCPSREYILLDIMDAINNLHLDAYSVVSSNLDGVLTLALKSTFRGAAIAPAGIIEQALWKIAGKC

cccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHEEEcEEEECccccccccEEEcccccEEEEccccccccHHHHHHHHHcccccEEEEEEEcccEEEECccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEEcccccccHHHHHHHHHHHHccc

MVPRVLEWGDGYYNGD*********************************************AALSPEDLTDAEWYYLVCMSFVFSSGQGLPGRALANSETIWLCNAQCADSKVFSRSLLAKSASIQTVICFPHLDGVIELGVTELVPEDPSLLQHIKASLLDFSKP************************************************************************************************************************************************************************RKT*SAIFGSSNRLTE*P************************PGIQQNLLKKILFSVPLMHG**************************E***********KFMVLRSMVPYISEVDKASILSDTIKYLKKLEARVEELESC***********************************************************DGLADVKVSIQEMDVLIEMRCPSREYILLDIMDAINNLHLDAYSVVSSNLDGVLTLALKSTFRGAAIAPAGIIEQALWKIAGKC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor GLABRA 3	Transcription activator, when associated with MYB75/PAP1, MYB90/PAP2 or TT2. Involved in epidermal cell fate specification. Regulates negatively stomata formation, but, in association with TTG1 and MYB0/GL1, promotes trichome formation, branching and endoreplication. Regulates also trichome cell wall maturation. Together with MYB66/WER, promotes the formation of non-hair cells in root epidermis cells in the N position. Whereas together with CPC, promotes the formation of hair cells in root epidermis cells in the H position by inhibiting non-hair cell formation. Seems also to play a role in the activation of anthocyanin biosynthesis, probably together with MYB75/PAP1. Activates the transcription of GL2.	probable	Q9FN69

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HLO, chain A
Confidence level:confident
Coverage over the Query: 419-479
View the alignment between query and template
View the model in PyMOL

Template: 3DBA, chain A
Confidence level:probable
Coverage over the Query: 82-160
View the alignment between query and template
View the model in PyMOL

Template: 3N0V, chain A
Confidence level:probable
Coverage over the Query: 548-616
View the alignment between query and template
View the model in PyMOL