Citrus Sinensis ID: 007123

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------

MDNKHQHPQPQPQLSLAKSSRQRCNEWIFRDVPSDITIDVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDISRIELLNLPGGAETFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEDFSKDNLGSRAEEYIDCIVCKNLEMCVEVLQQCESLLPLADELKIVSRCIDAVASKACAEQIASSFSRLEYSSSGRLHMNKHTKCEGDWWIEDLSVLRFDLYQRVMTAMKCRGVRPESIGASLMNYAQKELTKKSSLWNPTTQAKVDLVSVPSGHERQVVETIIGLLPVEKLAVPINFLFGLLRSAVMLDCTVACRLDLERRIASQLDIAALDDLLIPSFRHAGDTLFDVDTVHRILVNFAQQDDSEDEMDDASVFESDSPHSPSQTALLKVAKLVDNYLAEIAPDANLKLAKFMVIAETLPSHARTVHDGLYRAIDIYLKAHQNLSDSDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNALSCSYGDEEHKPVHQSWRISSGALSAAMSPRDNYASLRRENRELKLELARLRMRLNDLEKEHVCMKRDMVKSHSRKFMSSFSRKIGKLSFFGHSSSRGSSSPSKNSYRTDSKVIERTCASTD

ccccccccccccccHHHHHHHHHcccHHHccccCEEEEEEccEEEEEcccccccccHHHHHHHcccccccccEEECccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********************CNEWIFRDVPSDITIDVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDISRIELLNLPGGAETFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEDFSKDNLGSRAEEYIDCIVCKNLEMCVEVLQQCESLLPLADELKIVSRCIDAVASKACAEQIASSF*****************KCEGDWWIEDLSVLRFDLYQRVMTAMKCRGVRPESIGASLMNYAQKELT********************SGHERQVVETIIGLLPVEKLAVPINFLFGLLRSAVMLDCTVACRLDLERRIASQLDIAALDDLLIPSFRHAGDTLFDVDTVHRILVNFA**************************ALLKVAKLVDNYLAEIAPDANLKLAKFMVIAETLPSHARTVHDGLYRAIDIYLKAHQNLSDSDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNALSCS**********************************************L***********************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDNKHQHPQPQPQLSLAKSSRQRCNEWIFRDVPSDITIDVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDISRIELLNLPGGAETFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEDFSKDNLGSRAEEYIDCIVCKNLEMCVEVLQQCESLLPLADELKIVSRCIDAVASKACAEQIASSFSRLEYSSSGRLHMNKHTKCEGDWWIEDLSVLRFDLYQRVMTAMKCRGVRPESIGASLMNYAQKELTKKSSLWNPTTQAKVDLVSVPSGHERQVVETIIGLLPVEKLAVPINFLFGLLRSAVMLDCTVACRLDLERRIASQLDIAALDDLLIPSFRHAGDTLFDVDTVHRILVNFAQQDDSEDEMDDASVFESDSPHSPSQTALLKVAKLVDNYLAEIAPDANLKLAKFMVIAETLPSHARTVHDGLYRAIDIYLKAHQNLSDSDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNALSCSYGDEEHKPVHQSWRISSGALSAAMSPRDNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMVKSHSRKFMSSFSRKIGKLSFFGHSSSRGSSSPSKNSYRTDSKVIERTCASTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BTB/POZ domain-containing protein At5g48800	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	confident	Q9FKB6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R29, chain A
Confidence level:very confident
Coverage over the Query: 15-136
View the alignment between query and template
View the model in PyMOL

Template: 3I3N, chain A
Confidence level:confident
Coverage over the Query: 15-181,206-254,273-325
View the alignment between query and template
View the model in PyMOL