Citrus Sinensis ID: 007169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-----
MDSTAAQRRLKAIHGHLLCADDSSSSQLRHNPTAGEYALEQGYSVVLPEKLDTGKWNVYRSSRSPLKLVSRFPDHPEIGTTHDNFVRAVDTFRDYKYLGTRVRVDGTVGEYKWMTYGEAGTARTEVGSGLIYHGISKGSCIGLYFVNRPEWLIVDHACSAYSFISVPLYDTLGPDAVKYIVNHASVQAVFCVPQTLNSLLSCLSEVPTVRLIVVIGGIDDQIPSLPITTGVQILTYSNLLSQGRSNLQPFSPPKPDDVATICYTSGTTGTPKGAVLSHGNLIASVAGATLGTKFYPSDVYISYLPLAHIYERANQVMTVYSGVAVGFYQGDNMKLMDDMAALRPTVFCSVPRLYNRIYAGITSAVRTSGGLRERLFNAAYNAKKQAMLSGKNPSPMWDRLVFNKIKDKLGGRVRFMGSGASPLSPDVLDFLKICFGGRVTEGYGMTETSCLISQLDEGDNLSGHVGSPNAACEIKLVDVPEMNYTSEDQPCPRGEICVRGPLIFKGYYKDEIQTKEVIDEDGWFHTGDIGMWIPGGRLKIIDRKKNIFKLAQGEYIAAEKIENVYAKCKFVGQCFVYGDSFNSALVAIVSVDQDALKAWAASEGIQVTFSWLSVS
ccHHHHHHHHHHHHccccccccccccccccccccccccccccCEEEcccccccccccEEEccccccccccccccccccccHHHHHHHHHHHccccccCEEEEcccccccccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHccccEEEEccccHHHHHHccccccccEEEEEEccccccccccccccccEEEEHHHHHHHcccccccccccccccEEEEEEccccccccccEEccHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEEccccHHccccccccccccccccccccccccCEEEEEEccccccccccccccccEEEEccccccccccccHHHHHHHHcccccccccccCEECccccEEEEEccccHHHcccccEEcHHHHHHHHHccccccEEEEECcccccEEEEEEEccHHHHHHHHHHccccccHHHHHcc
*****************L*****************EYALEQGYSVVLPEKLDTGKWNVYRSSRSPLKLVSRFPDHPEIGTTHDNFVRAVDTFRDYKYLGTRVRVDGTVGEYKWMTYGEAGTARTEVGSGLIYHGISKGSCIGLYFVNRPEWLIVDHACSAYSFISVPLYDTLGPDAVKYIVNHASVQAVFCVPQTLNSLLSCLSEVPTVRLIVVIGGIDDQIPSLPITTGVQILTYSNLLSQ**********PKPDDVATICYTSGTTGTPKGAVLSHGNLIASVAGATLGTKFYPSDVYISYLPLAHIYERANQVMTVYSGVAVGFYQGDNMKLMDDMAALRPTVFCSVPRLYNRIYAGITSAVRTSGGLRERLFNAAYNAKKQAMLSGKNPSPMWDRLVFNKIKDKLGGRVRFMGSGASPLSPDVLDFLKICFGGRVTEGYGMTETSCLISQLDEGDNLSGHVGSPNAACEIKLVDVPEMNYTSEDQPCPRGEICVRGPLIFKGYYKDEIQTKEVIDEDGWFHTGDIGMWIPGGRLKIIDRKKNIFKLAQGEYIAAEKIENVYAKCKFVGQCFVYGDSFNSALVAIVSVDQDALKAWAASEGIQVTFSWLSVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTAAQRRLKAIHGHLLCADDSSSSQLRHNPTAGEYALEQGYSVVLPEKLDTGKWNVYRSSRSPLKLVSRFPDHPEIGTTHDNFVRAVDTFRDYKYLGTRVRVDGTVGEYKWMTYGEAGTARTEVGSGLIYHGISKGSCIGLYFVNRPEWLIVDHACSAYSFISVPLYDTLGPDAVKYIVNHASVQAVFCVPQTLNSLLSCLSEVPTVRLIVVIGGIDDQIPSLPITTGVQILTYSNLLSQGRSNLQPFSPPKPDDVATICYTSGTTGTPKGAVLSHGNLIASVAGATLGTKFYPSDVYISYLPLAHIYERANQVMTVYSGVAVGFYQGDNMKLMDDMAALRPTVFCSVPRLYNRIYAGITSAVRTSGGLRERLFNAAYNAKKQAMLSGKNPSPMWDRLVFNKIKDKLGGRVRFMGSGASPLSPDVLDFLKICFGGRVTEGYGMTETSCLISQLDEGDNLSGHVGSPNAACEIKLVDVPEMNYTSEDQPCPRGEICVRGPLIFKGYYKDEIQTKEVIDEDGWFHTGDIGMWIPGGRLKIIDRKKNIFKLAQGEYIAAEKIENVYAKCKFVGQCFVYGDSFNSALVAIVSVDQDALKAWAASEGIQVTFSWLSVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long chain acyl-CoA synthetase 7, peroxisomal Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitate, palmitoleate, oleate, linoleate and eicosenoate. Displays redundant function with LACS7 into the seed development process.confidentQ8LKS5
Long chain acyl-CoA synthetase 6, peroxisomal Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitate, palmitoleate, oleate, linoleate and eicosenoate. Might play a regulatory role both in fatty acid import into glyoxysomes and in fatty acid beta-oxidation. Displays redundant function with LACS7 into the seed development process.probableQ8LPS1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.2.-.-Forming carbon-sulfur bonds.probable
6.2.1.-Acid--thiol ligases.probable
6.2.1.3Long-chain-fatty-acid--CoA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TSY, chain A
Confidence level:very confident
Coverage over the Query: 75-362,405-567
View the alignment between query and template
View the model in PyMOL
Template: 2D1Q, chain A
Confidence level:confident
Coverage over the Query: 115-354,386-564
View the alignment between query and template
View the model in PyMOL
Template: 3A9U, chain A
Confidence level:confident
Coverage over the Query: 115-154,171-310,341-562
View the alignment between query and template
View the model in PyMOL