Citrus Sinensis ID: 007303

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MGHGSSKEDESVSRTSRFRKKFHLHRERRRSRGNGSNSGSHHHNRVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYSRSHSHSHSRFGLLLC
ccccccccccccccccccccccHHHHHHccccccccccccccccEEcccccccccEEEEEEEEEccccccEEEEEEccccEEcccccccccccccccccccccccccccEEEEEEcccEEEEEEEcccccccccccccccccccccEEEEEEEEEcccccccccEEEEEEEHHHHHHccccccccEEEccccccccccccEEEEEEEEccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEccccccccEEEEcccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccEEEEccccccHHHccccccccccccccEEEEEEEccccccEEEEccccEEEEEEEEccccccccHHHHHHccccccccEEEEEEEEEccccccEEEEEccccccccccccccc
cccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcHcccHHHHHHHEEEEcccccccEEEEEEccccEEEccccccccccccccccccHHccccccEEEEEEcEEEEEcccEcccccccccHHcEEEEEccccEEEEEEEEEcccccccccEEEEEEEHHHHHcccccccccEEEcccccccccEEEEEEEEEEEEccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccEcHHHHHHHHHHcccccccEcccccccccccccccccEEEEHHHHccHcccccEEEcccccHHHHHHHHHHHHHHHHHccccEEcccccccEEEEEEEcccccEEEEEHHHHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHccHHHHccHHHHHHHHcccccccccccccccEEEEccccEEEEEcccccccEEEEEccEEEHHHHHccHHHHHHHccccEEEEEEccccccEEEccccccccccEEEcccEEEccHHHHHHccccEEEEcEEEEEEEcccccccEEEEEEcccccccccEEEcc
mghgsskedesvsrtSRFRKKFHLHRErrrsrgngsnsgshhhnrvlneedFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFwcstdkpiwnseKKLLletngphvarISVFETnrlsksnlegycevdllefltkdsdadsevfdlldpsssnkivgkislscsvedpietEKSFARRILSIVdynqdgqlsFKEFSDLISAFGNQVAANKKEELFKAadkngdgvVSVDELAALLALQQekeplmnccpvcgetlEVADMVNTMIHLTLcfdegtgnqvmtggfltdkqasNVWMFKlsewghfssydvglnsgsrahILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKqgrkmnsvesskeipKFVNFFKDQInladvkyplehfKTFNEFFIRelkpgarpidcmeREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQgllgndicsnsflngTMVIFrlapqdyhrfhlpvsgiieqfvdipgclytvnpiavnskycnvftenKRVVSIISTAhfgkvchysrshshshsrfglllc
mghgsskedesvsrtsrfrkkfhlhrerrrsrgngsnsgshhhnrvlneEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVfetnrlsksnlEGYCEVDLLEFLTKDSDADSEVFdlldpsssnkivgkislscsvedpiETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISekqgrkmnsvesskeipkFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHysrshshshsrfglllc
MGHGSSKEDESVSRTSRFRKKFHLhrerrrsrgngsnsgshhhnrVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDssfmltlfsflfVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDElaallalQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYsrshshshsrFGLLLC
**********************************************LNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKD******VFDLL******KIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELL*******************IPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYS***************
********************************************RVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAIS**L*T*A*LQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSS***IVGKISLSCSVEDPIETEKSFARRILSIVD******LSFKEFSDLISAFGNQVAA*********************************EPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYSRSHSHSHS*FGLLLC
****************RFRKKF********************HNRVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISE************KEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCH***********FGLLLC
*************************************SGSHHHNRVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYSRSHSHSHSRFGLLLC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHGSSKEDESVSRTSRFRKKFHLHRERRRSRGNGSNSGSHHHNRVLNEEDFAGIALLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYSRSHSHSHSRFGLLLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query608 2.2.26 [Sep-21-2011]
O14111967 Phosphatidylserine decarb yes no 0.485 0.305 0.371 3e-49
P53037 1138 Phosphatidylserine decarb yes no 0.476 0.254 0.358 7e-40
Q8RGF2300 Phosphatidylserine decarb yes no 0.296 0.6 0.383 3e-32
A0Q3R9295 Phosphatidylserine decarb yes no 0.353 0.728 0.363 7e-31
P0CD79301 Phosphatidylserine decarb yes no 0.253 0.511 0.401 4e-28
Q3KKZ5301 Phosphatidylserine decarb yes no 0.253 0.511 0.401 4e-28
B0B8S5301 Phosphatidylserine decarb yes no 0.253 0.511 0.401 4e-28
B0BAF4301 Phosphatidylserine decarb yes no 0.253 0.511 0.401 4e-28
Q0TV39294 Phosphatidylserine decarb yes no 0.356 0.738 0.349 3e-27
Q0SWT6294 Phosphatidylserine decarb yes no 0.356 0.738 0.344 8e-27
>sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 Back     alignment and function desciption
 Score =  196 bits (499), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/304 (37%), Positives = 175/304 (57%), Gaps = 9/304 (2%)

Query: 289 MNCCPVCGE-TLEVADMVNTMIHLTLC--FDEGTGNQVMTGGFLTDKQASNVWMFKLSEW 345
           ++ CP+C +  L   +     +HL  C   D    +++M   +++  QA   W  K    
Sbjct: 578 LSNCPLCLKFKLSKVNQQKATVHLATCASHDWKRVDRLMMTSYVSLNQAQRRWFSKAFAK 637

Query: 346 GHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKE 405
             + S  VG  S   A  LV +R+T ++ EE ++  + + +R +Y+      +     K+
Sbjct: 638 VVYGSSKVGSTS---ATTLVQNRQTGQIQEEKMNAYVRIGIRLLYRGIRNRRIEGSKVKK 694

Query: 406 LLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGA 465
           +L+S++ KQG K +S  S KEI  F+ FF   +N+ +V  P+  FKTFNEFF R+LKPG+
Sbjct: 695 ILRSLTLKQGMKYDSPISVKEIKPFIRFF--DLNMNEVDMPVGGFKTFNEFFYRKLKPGS 752

Query: 466 RPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMV 525
           RP    +  ++ V  ADSR++A++ +E +  +WIKG +F+++ LLG    +  F+ G++ 
Sbjct: 753 RPCAFPDNPDILVSPADSRIVAYECIEKATTYWIKGTEFTVERLLGYSNEAQRFVGGSIC 812

Query: 526 IFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAH 585
           I RLAPQDYHRFH PV+G I     I G  YTVNP+A+ S Y +VF EN RV+  I +  
Sbjct: 813 ISRLAPQDYHRFHSPVNGCIGPITKIEGQYYTVNPMAIRS-YLDVFGENVRVLIPIDSNE 871

Query: 586 FGKV 589
           FGKV
Sbjct: 872 FGKV 875
May be involved in the regulation of phospholipid biosynthesis and interorganelle trafficking of phosphatidylserine (By similarity). Together with psd1 and psd2, responsible for the majority of phosphatidylethanolamine synthesis.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 5
>sp|P53037|PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSD2 PE=1 SV=1 Back     alignment and function description
>sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|P0CD79|PSD_CHLTR Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|Q3KKZ5|PSD_CHLTA Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|B0B8S5|PSD_CHLT2 Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|B0BAF4|PSD_CHLTB Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 Back     alignment and function description
>sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query608
225447822640 PREDICTED: C2 domain-containing protein 0.889 0.845 0.718 0.0
356525902627 PREDICTED: C2 domain-containing protein 0.898 0.870 0.707 0.0
357445723631 Phosphatidylserine decarboxylase [Medica 0.896 0.863 0.675 0.0
240256448635 phosphatidylserine decarboxylase 2 [Arab 0.904 0.866 0.671 0.0
126673485648 phosphatidylserine decarboxylase [Arabid 0.904 0.848 0.670 0.0
297803508636 phosphatidylserine decarboxylase [Arabid 0.901 0.861 0.677 0.0
255570988633 phosphatidylserine decarboxylase, putati 0.853 0.819 0.688 0.0
186513660635 phosphatidylserine decarboxylase 3 [Arab 0.899 0.861 0.681 0.0
449478940661 PREDICTED: LOW QUALITY PROTEIN: phosphat 0.907 0.835 0.677 0.0
8843821615 phosphatidylserine decarboxylase [Arabid 0.871 0.861 0.644 0.0
>gi|225447822|ref|XP_002267948.1| PREDICTED: C2 domain-containing protein C31G5.15-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/594 (71%), Positives = 477/594 (80%), Gaps = 53/594 (8%)

Query: 1   MGHGSSK----EDESVSRTSRFRKKFHLHRERRRSRGNGSNSGSHHHNRVLNEEDFAGIA 56
           MG+GSSK    +D S SR +R  +K H                S  HN+ L  EDFAGIA
Sbjct: 1   MGNGSSKSTHQQDSSSSRVARVWRKIHHSS---------HRHVSSSHNKRLAAEDFAGIA 51

Query: 57  LLTLISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFS 116
           LLTL  AEMKFKDKWLACVS+GEQT RT  SD+                           
Sbjct: 52  LLTLHGAEMKFKDKWLACVSVGEQTFRTETSDQ--------------------------- 84

Query: 117 FLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFL 176
                      TDKP+WNSEKK L+E NGPH+ARIS+FETNRLSKSNL G+CE+DL EFL
Sbjct: 85  -----------TDKPVWNSEKKFLMERNGPHIARISIFETNRLSKSNLVGHCEIDLFEFL 133

Query: 177 TKDSDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSF 236
           T+DS++DSEV DL DPSSS   VGKI +SCSVEDP ETE+SF RRILSIVDYN+DG+LS 
Sbjct: 134 TQDSESDSEVLDLFDPSSSGIAVGKIKVSCSVEDPTETERSFVRRILSIVDYNEDGKLSS 193

Query: 237 KEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCG 296
            EFS+LI AFGNQVAA KKEELFKAADKN DGVVS+DEL  LLA+QQEKEPL++CCPVCG
Sbjct: 194 SEFSELIKAFGNQVAAEKKEELFKAADKNEDGVVSMDELTVLLAIQQEKEPLISCCPVCG 253

Query: 297 ETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLN 356
           E L+ +D +N MIH+ LCFDEGTGNQVMTGGFLTDKQAS  WMFKLSEW HFSSYD+GLN
Sbjct: 254 EVLD-SDKLNNMIHMNLCFDEGTGNQVMTGGFLTDKQASYGWMFKLSEWAHFSSYDIGLN 312

Query: 357 SGSRA-HILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQG 415
           SGS A HILVFDRRTKRLVEELID KIV+SMRAIYQSK+GLGLMD G KELL+ ISEKQG
Sbjct: 313 SGSSASHILVFDRRTKRLVEELIDGKIVLSMRAIYQSKLGLGLMDAGAKELLQRISEKQG 372

Query: 416 RKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREE 475
           ++MNSVES+K+IPKF+ FF+DQI L +VKYPLEHFKTFNEFFIRELKPGARPI CMER++
Sbjct: 373 KQMNSVESAKDIPKFLKFFEDQIKLDEVKYPLEHFKTFNEFFIRELKPGARPIACMERDD 432

Query: 476 VAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYH 535
           VAVCAADSRL AFKSVEDSLRFWIKG+KFSIQGLLG +ICS+SF+NG++VIFRLAPQDYH
Sbjct: 433 VAVCAADSRLTAFKSVEDSLRFWIKGRKFSIQGLLGKEICSSSFINGSLVIFRLAPQDYH 492

Query: 536 RFHLPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKV 589
           RFH PVSG IE FVDIPGCLYTVNPIAVNSKYCNVFTENKRVVS+IST+ FGKV
Sbjct: 493 RFHFPVSGTIECFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSVISTSDFGKV 546

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525902|ref|XP_003531560.1| PREDICTED: C2 domain-containing protein C31G5.15-like [Glycine max] Back     alignment and taxonomy information
>gi|357445723|ref|XP_003593139.1| Phosphatidylserine decarboxylase [Medicago truncatula] gi|355482187|gb|AES63390.1| Phosphatidylserine decarboxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|240256448|ref|NP_200529.4| phosphatidylserine decarboxylase 2 [Arabidopsis thaliana] gi|332009481|gb|AED96864.1| phosphatidylserine decarboxylase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|126673485|gb|ABO26298.1| phosphatidylserine decarboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297803508|ref|XP_002869638.1| phosphatidylserine decarboxylase [Arabidopsis lyrata subsp. lyrata] gi|297315474|gb|EFH45897.1| phosphatidylserine decarboxylase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255570988|ref|XP_002526445.1| phosphatidylserine decarboxylase, putative [Ricinus communis] gi|223534225|gb|EEF35940.1| phosphatidylserine decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|186513660|ref|NP_567736.3| phosphatidylserine decarboxylase 3 [Arabidopsis thaliana] gi|126673483|gb|ABO26297.1| phosphatidylserine decarboxylase [Arabidopsis thaliana] gi|332659738|gb|AEE85138.1| phosphatidylserine decarboxylase 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449478940|ref|XP_004155459.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylserine decarboxylase proenzyme 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|8843821|dbj|BAA97369.1| phosphatidylserine decarboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query608
TAIR|locus:2175574635 PSD2 "phosphatidylserine decar 0.759 0.727 0.730 6.1e-207
TAIR|locus:2120820635 PSD3 "phosphatidylserine decar 0.756 0.724 0.737 7.9e-205
DICTYBASE|DDB_G0282337563 DDB_G0282337 "putative phospha 0.368 0.397 0.412 1.8e-52
ASPGD|ASPL00000359521053 AN3188 [Emericella nidulans (t 0.478 0.276 0.378 6.4e-49
POMBASE|SPAC31G5.15967 psd3 "phosphatidylserine decar 0.480 0.301 0.375 8e-46
CGD|CAL0003011 1070 orf19.3954 [Candida albicans ( 0.679 0.385 0.317 6e-45
UNIPROTKB|Q5AK66 1070 PSD2 "Putative uncharacterized 0.679 0.385 0.317 6e-45
SGD|S000003402 1138 PSD2 "Phosphatidylserine decar 0.475 0.253 0.360 8.9e-39
ASPGD|ASPL0000009559347 AN7989 [Emericella nidulans (t 0.287 0.504 0.406 5.5e-31
UNIPROTKB|Q9KV19285 psd "Phosphatidylserine decarb 0.274 0.585 0.371 1.8e-23
TAIR|locus:2175574 PSD2 "phosphatidylserine decarboxylase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1824 (647.1 bits), Expect = 6.1e-207, Sum P(2) = 6.1e-207
 Identities = 339/464 (73%), Positives = 409/464 (88%)

Query:   127 STDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKDSDADSEV 186
             +T KPIWNSEKKLLLE NGP +AR+SVFETNR++++ + GYCE+D+ +F+ ++ ++  + 
Sbjct:    88 TTQKPIWNSEKKLLLEKNGPSLARVSVFETNRVARNKIIGYCELDIFDFVVQEPESTCKS 147

Query:   187 FDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAF 246
             F+LLDP+SSN +VG I LSC++EDP+ETE+ FA+RILSIVDYN+DGQLSF EFSDLI AF
Sbjct:   148 FNLLDPTSSN-VVGSIFLSCAIEDPVETERRFAKRILSIVDYNEDGQLSFSEFSDLIKAF 206

Query:   247 GNQVAANKKEELFKAADKNGDGVVSVDEXXXXXXXQQEKEPLMNCCPVCGETLEVADMVN 306
             GN VAANKKEELFKAAD NGDGVV++DE       QQE+EP++N CPVCGE L+V+D +N
Sbjct:   207 GNLVAANKKEELFKAADLNGDGVVTIDELAALLALQQEQEPIINNCPVCGEALQVSDKLN 266

Query:   307 TMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRA-HILV 365
              MIH+TLCFDEGTGNQVMTGGFLTD+QAS  WMFKLSEW H S+YDVGLN+GS A +I+V
Sbjct:   267 AMIHMTLCFDEGTGNQVMTGGFLTDRQASYGWMFKLSEWTHLSTYDVGLNTGSSASYIVV 326

Query:   366 FDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKMNSVESSK 425
              DR++KRLVEELID KIV+SMRAIYQSKIGL LMD G KE+L+ +SEKQG+KM+SVES++
Sbjct:   327 IDRKSKRLVEELIDSKIVLSMRAIYQSKIGLRLMDQGAKEILQRLSEKQGKKMSSVESAQ 386

Query:   426 EIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAVCAADSRL 485
             +IP+F+ FFKDQIN+A+VKYPL+HFKTFNEFFIRELKPGARPI CM R +VAVCAAD RL
Sbjct:   387 KIPRFLEFFKDQINMAEVKYPLQHFKTFNEFFIRELKPGARPIACMNRNDVAVCAADCRL 446

Query:   486 MAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGII 545
             MAF+SVEDS RFWIKG+KFSI+GLLG ++  N+FL+G++VIFRLAPQDYHRFH+PVSG+I
Sbjct:   447 MAFQSVEDSTRFWIKGKKFSIRGLLGKNVNPNAFLDGSLVIFRLAPQDYHRFHVPVSGVI 506

Query:   546 EQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKV 589
             EQFVD+ G LYTVNPIAVNSKYCNVFTENKR V+IISTA FGKV
Sbjct:   507 EQFVDVSGSLYTVNPIAVNSKYCNVFTENKRTVAIISTAEFGKV 550
GO:0004609 "phosphatidylserine decarboxylase activity" evidence=IEA;ISS;IMP;IDA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008654 "phospholipid biosynthetic process" evidence=IEA;ISS
GO:0009705 "plant-type vacuole membrane" evidence=IDA
TAIR|locus:2120820 PSD3 "phosphatidylserine decarboxylase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282337 DDB_G0282337 "putative phosphatidylserine decarboxylase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035952 AN3188 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC31G5.15 psd3 "phosphatidylserine decarboxylase Psd3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0003011 orf19.3954 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AK66 PSD2 "Putative uncharacterized protein PSD2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000003402 PSD2 "Phosphatidylserine decarboxylase of the Golgi and vacuolar membranes" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009559 AN7989 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KV19 psd "Phosphatidylserine decarboxylase proenzyme" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.65LOW CONFIDENCE prediction!
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PSD2
PSD2 (phosphatidylserine decarboxylase 2); phosphatidylserine decarboxylase; Encodes the minor form of the two non-mitochondrail phosphatidylserine decarboxylase. The gene expression level is very low. Located at the tonoplast. (635 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AAPT1
AAPT1 (AMINOALCOHOLPHOSPHOTRANSFERASE 1); phosphatidyltransferase/ phosphotransferase, for othe [...] (389 aa)
     •• 0.963
PLDALPHA1
PLDALPHA1 (PHOSPHOLIPASE D ALPHA 1); phospholipase D; Encodes phospholipase D alpha 1 (PLD alph [...] (810 aa)
     •• 0.914
PLDALPHA2
PLDALPHA2 (phosphlipase d alpha 2); phospholipase D; member of C2-PLD subfamily ; Hydrolyzes gl [...] (810 aa)
     •• 0.911
PLDBETA1
PLDBETA1 (PHOSPHOLIPASE D BETA 1); phospholipase D; phospholipase D (PLDbeta) ; Hydrolyzes glyc [...] (1083 aa)
     •• 0.902
PLDP1
PLDP1 (PHOSPHOLIPASE D P1); phospholipase D; Encodes a member of the PXPH-PLD subfamily of phos [...] (1096 aa)
     •• 0.902
PLDP2
PLDP2; phospholipase D; Encodes a member of the PXPH-PLD subfamily of phospholipase D proteins. [...] (1046 aa)
     •• 0.902
PLDDELTA
ATPLDDELTA; phospholipase D; Encodes a protein with phospholipase D activity. Involved in phosp [...] (868 aa)
     •• 0.902
PLDALPHA3
PLDALPHA3 (PHOSPHLIPASE D ALPHA 3); phospholipase D; member of C2-PLD subfamily. Analyses on th [...] (820 aa)
     •  0.899
SDP1
SDP1 (SUGAR-DEPENDENT1); triacylglycerol lipase; Encodes a triacylglycerol lipase that is invol [...] (825 aa)
     •  0.899
PLDGAMMA1
PLDGAMMA1; phospholipase D; phospholipase D (gamma) ; Hydrolyzes glycerol-phospholipids at the [...] (858 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query608
PLN02964644 PLN02964, PLN02964, phosphatidylserine decarboxyla 0.0
PRK00723297 PRK00723, PRK00723, phosphatidylserine decarboxyla 9e-57
pfam02666201 pfam02666, PS_Dcarbxylase, Phosphatidylserine deca 5e-43
COG0688239 COG0688, Psd, Phosphatidylserine decarboxylase [Li 6e-35
PRK00044288 PRK00044, psd, phosphatidylserine decarboxylase; R 5e-33
PRK03140259 PRK03140, PRK03140, phosphatidylserine decarboxyla 6e-27
TIGR00163238 TIGR00163, PS_decarb, phosphatidylserine decarboxy 1e-25
PRK03934265 PRK03934, PRK03934, phosphatidylserine decarboxyla 1e-22
PRK09629610 PRK09629, PRK09629, bifunctional thiosulfate sulfu 3e-17
PTZ00403353 PTZ00403, PTZ00403, phosphatidylserine decarboxyla 3e-13
PLN02938428 PLN02938, PLN02938, phosphatidylserine decarboxyla 7e-10
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-09
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 3e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 1e-05
pfam1320225 pfam13202, EF_hand_3, EF hand 8e-04
>gnl|CDD|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase Back     alignment and domain information 
 Score =  978 bits (2529), Expect = 0.0
 Identities = 412/591 (69%), Positives = 480/591 (81%), Gaps = 41/591 (6%)

Query: 1   MGHGSSKEDESVSRTSRFRKKFHLHRERRRSRGNGSNSGSHH-HNRVLNEEDFAGIALLT 59
           MG+G+S+E +  SR S+ R+K    R RRR       S S     R ++ EDF+GIALLT
Sbjct: 1   MGNGNSREAKE-SRRSKLRQKLQKFRIRRRHLRCSRGSSSGSVSQRAVSAEDFSGIALLT 59

Query: 60  LISAEMKFKDKWLACVSLGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLF 119
           L+ AEMKFKDKWLACVS GEQT RT  SD                               
Sbjct: 60  LVGAEMKFKDKWLACVSFGEQTFRTETSD------------------------------- 88

Query: 120 VISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFETNRLSKSNLEGYCEVDLLEFLTKD 179
                  STDKP+WNSEKKLLLE NGPH+ARISVFETNRLSK+ L GYCE+DL +F+T++
Sbjct: 89  -------STDKPVWNSEKKLLLEKNGPHLARISVFETNRLSKNTLVGYCELDLFDFVTQE 141

Query: 180 SDADSEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEF 239
            ++  E FDLLDPSSSNK+VG I +SCS+EDP+ETE+SFARRIL+IVDY++DGQLSF EF
Sbjct: 142 PESACESFDLLDPSSSNKVVGSIFVSCSIEDPVETERSFARRILAIVDYDEDGQLSFSEF 201

Query: 240 SDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETL 299
           SDLI AFGN VAANKKEELFKAAD NGDGVV++DELAALLALQQE+EP++N CPVCGE L
Sbjct: 202 SDLIKAFGNLVAANKKEELFKAADLNGDGVVTIDELAALLALQQEQEPIINNCPVCGEAL 261

Query: 300 EVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGS 359
            V+D +N MIH+TLCFDEGTGNQVMTGGFLTDKQAS  WMFKLSEW H S+YDVGLN+GS
Sbjct: 262 GVSDKLNAMIHMTLCFDEGTGNQVMTGGFLTDKQASYGWMFKLSEWAHLSTYDVGLNTGS 321

Query: 360 RA-HILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGLMDIGTKELLKSISEKQGRKM 418
            A HILVFDR++KRLVEELID KIV+SMRAIYQSKIGL LMD G KE+L+ +SEKQG+KM
Sbjct: 322 SASHILVFDRKSKRLVEELIDSKIVLSMRAIYQSKIGLRLMDQGAKEILQRLSEKQGKKM 381

Query: 419 NSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMEREEVAV 478
           NSVES+++IPKF+ FFKDQIN+ +VKYPLEHFKTFNEFFIRELKPGARPI CM+ ++VAV
Sbjct: 382 NSVESAQDIPKFLEFFKDQINMDEVKYPLEHFKTFNEFFIRELKPGARPIACMDNDDVAV 441

Query: 479 CAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFH 538
           CAAD RLMAF+SV+DS RFWIKG+KFSI+GLLG  + S++FL+G++VIFRLAPQDYHRFH
Sbjct: 442 CAADCRLMAFQSVDDSTRFWIKGRKFSIKGLLGKKVHSDAFLDGSLVIFRLAPQDYHRFH 501

Query: 539 LPVSGIIEQFVDIPGCLYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKV 589
           +PVSG+IE+FVD+PG LYTVNPIAVNSKYCNVFTENKR V IISTA FGKV
Sbjct: 502 VPVSGVIEKFVDVPGSLYTVNPIAVNSKYCNVFTENKRAVCIISTAEFGKV 552

Length = 644
>gnl|CDD|179097 PRK00723, PRK00723, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|217173 pfam02666, PS_Dcarbxylase, Phosphatidylserine decarboxylase Back     alignment and domain information
>gnl|CDD|223760 COG0688, Psd, Phosphatidylserine decarboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|234591 PRK00044, psd, phosphatidylserine decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|179544 PRK03140, PRK03140, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|232850 TIGR00163, PS_decarb, phosphatidylserine decarboxylase precursor Back     alignment and domain information
>gnl|CDD|235177 PRK03934, PRK03934, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|104071 PRK09629, PRK09629, bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|173594 PTZ00403, PTZ00403, phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|178526 PLN02938, PLN02938, phosphatidylserine decarboxylase Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 608
PLN02964644 phosphatidylserine decarboxylase 100.0
KOG2419975 consensus Phosphatidylserine decarboxylase [Lipid 100.0
PRK00723297 phosphatidylserine decarboxylase; Provisional 100.0
PTZ00403353 phosphatidylserine decarboxylase; Provisional 100.0
PLN02938428 phosphatidylserine decarboxylase 100.0
PRK03140259 phosphatidylserine decarboxylase; Provisional 100.0
PRK00044288 psd phosphatidylserine decarboxylase; Reviewed 100.0
PRK03934265 phosphatidylserine decarboxylase; Provisional 100.0
PRK09629610 bifunctional thiosulfate sulfurtransferase/phospha 100.0
TIGR00163238 PS_decarb phosphatidylserine decarboxylase precurs 100.0
PF02666202 PS_Dcarbxylase: Phosphatidylserine decarboxylase; 100.0
KOG2420382 consensus Phosphatidylserine decarboxylase [Lipid 100.0
COG0688239 Psd Phosphatidylserine decarboxylase [Lipid metabo 100.0
TIGR00164189 PS_decarb_rel phosphatidylserine decarboxylase pre 99.89
PRK05305206 phosphatidylserine decarboxylase; Provisional 99.86
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.48
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.41
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.39
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.25
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.25
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.24
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.24
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.22
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.18
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.17
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.12
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.1
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.08
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.07
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.07
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.07
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.04
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.03
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.01
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.0
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 98.99
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 98.98
PTZ00183158 centrin; Provisional 98.97
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 98.97
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 98.97
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 98.96
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 98.96
PTZ00183158 centrin; Provisional 98.96
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 98.95
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 98.95
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 98.92
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 98.92
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 98.92
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 98.92
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 98.92
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.92
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 98.91
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 98.91
PTZ00184149 calmodulin; Provisional 98.91
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 98.9
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 98.9
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 98.89
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 98.89
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 98.89
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 98.88
KOG0696683 consensus Serine/threonine protein kinase [Signal 98.88
PTZ00184149 calmodulin; Provisional 98.88
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 98.87
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 98.87
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 98.87
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 98.86
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 98.85
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 98.85
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.84
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 98.83
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 98.82
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 98.81
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 98.81
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.81
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 98.81
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 98.8
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 98.79
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 98.79
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 98.79
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 98.79
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 98.78
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 98.78
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 98.78
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 98.77
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 98.77
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 98.77
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 98.77
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 98.76
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 98.76
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 98.75
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 98.74
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 98.74
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.74
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.74
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 98.74
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 98.74
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 98.73
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.73
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 98.73
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 98.73
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 98.71
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 98.7
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 98.69
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.68
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 98.67
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 98.67
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 98.66
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 98.65
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 98.65
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 98.65
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 98.65
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 98.64
PLN032002102 cellulose synthase-interactive protein; Provisiona 98.63
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 98.63
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 98.62
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.62
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 98.61
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.6
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 98.59
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.54
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 98.52
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 98.51
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 98.49
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 98.48
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.47
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.45
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.43
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.43
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.43
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.42
cd0005267 EH Eps15 homology domain; found in proteins implic 98.42
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.41
KOG0036463 consensus Predicted mitochondrial carrier protein 98.41
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.39
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.37
PLN03008 868 Phospholipase D delta 98.36
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.34
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.32
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 98.32
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 98.32
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 98.29
KOG0036463 consensus Predicted mitochondrial carrier protein 98.25
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.25
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 98.24
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.21
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 98.19
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.14
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.13
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 98.11
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.1
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 98.06
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.04
KOG1327529 consensus Copine [Signal transduction mechanisms] 98.0
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.97
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 97.96
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.89
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 97.89
PF1465866 EF-hand_9: EF-hand domain 97.76
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.71
PLN02964 644 phosphatidylserine decarboxylase 97.69
cd00030102 C2 C2 domain. The C2 domain was first identified i 97.66
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.64
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 97.56
PLN02952599 phosphoinositide phospholipase C 97.51
PLN02223537 phosphoinositide phospholipase C 97.46
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.38
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 97.34
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.33
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.33
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 97.32
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 97.2
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.19
PF1465866 EF-hand_9: EF-hand domain 97.19
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.18
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.17
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.15
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 97.14
PLN02230598 phosphoinositide phospholipase C 4 97.14
cd0005267 EH Eps15 homology domain; found in proteins implic 97.13
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.1
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.06
PLN02270 808 phospholipase D alpha 97.05
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.02
KOG0169746 consensus Phosphoinositide-specific phospholipase 96.99
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 96.99
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 96.95
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.95
PLN02222581 phosphoinositide phospholipase C 2 96.93
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.93
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.81
KOG0377631 consensus Protein serine/threonine phosphatase RDG 96.8
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 96.78
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 96.77
PLN02228567 Phosphoinositide phospholipase C 96.7
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 96.63
PF12588141 PSDC: Phophatidylserine decarboxylase ; InterPro: 96.6
cd0021388 S-100 S-100: S-100 domain, which represents the la 96.44
KOG4251362 consensus Calcium binding protein [General functio 96.34
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 96.34
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 96.32
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 96.21
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 96.18
KOG4666412 consensus Predicted phosphate acyltransferase, con 96.17
KOG12641267 consensus Phospholipase C [Lipid transport and met 96.0
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.96
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 95.87
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 95.85
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 95.71
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 95.6
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 95.58
cd0503088 calgranulins Calgranulins: S-100 domain found in p 95.58
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.18
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 95.05
KOG4065144 consensus Uncharacterized conserved protein [Funct 94.97
KOG0377631 consensus Protein serine/threonine phosphatase RDG 94.8
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 94.55
PLN02352 758 phospholipase D epsilon 94.47
KOG13261105 consensus Membrane-associated protein FER-1 and re 93.92
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 93.77
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.61
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 92.9
PRK12309391 transaldolase/EF-hand domain-containing protein; P 91.98
KOG4251362 consensus Calcium binding protein [General functio 91.94
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 90.86
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 90.52
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 90.46
KOG4666412 consensus Predicted phosphate acyltransferase, con 89.78
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 88.86
KOG4578421 consensus Uncharacterized conserved protein, conta 87.96
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 87.3
KOG3555434 consensus Ca2+-binding proteoglycan Testican [Gene 87.12
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 85.9
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 85.83
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 85.78
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 85.14
KOG0169 746 consensus Phosphoinositide-specific phospholipase 83.36
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 83.06
PRK09439169 PTS system glucose-specific transporter subunit; P 82.9
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 81.78
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information 
Probab=100.00  E-value=6.6e-126  Score=1049.15  Aligned_cols=560  Identities=74%  Similarity=1.186  Sum_probs=527.7

Q ss_pred             CCCCCCCCCchhhhhhHhhhcccccchhhc----cCCCCCCCCCccccccccccceeeEEEEEEeeeeeccCCCceEEEe
Q 007303            1 MGHGSSKEDESVSRTSRFRKKFHLHRERRR----SRGNGSNSGSHHHNRVLNEEDFAGIALLTLISAEMKFKDKWLACVS   76 (608)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~d~~~~~~~   76 (608)
                      |||++|++++ +||++++++|++-.|.++|    ++|+.+|   +.+++.+++|+|+|||+|||++|+|.++|||++|++
T Consensus         1 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   76 (644)
T PLN02964          1 MGNGNSREAK-ESRRSKLRQKLQKFRIRRRHLRCSRGSSSG---SVSQRAVSAEDFSGIALLTLVGAEMKFKDKWLACVS   76 (644)
T ss_pred             CCCCCCCccc-cCCcchHHHHHHHHHHHHHhhhhccCCCCc---cccccceecccccCeEEEEeehhhhccCCcEEEEEE
Confidence            9999999776 8999999999998655543    4444444   455899999999999999999999999999999999


Q ss_pred             cCcceEEeeeehhhhhhHhhccccchhhhhchhhhHHHHHHHhhhhhcccCCCCCccccccceeeccCCCcceeeEEeec
Q 007303           77 LGEQTCRTAISDKLRTFARLQNSHFFCLLVDSSFMLTLFSFLFVISFFWCSTDKPIWNSEKKLLLETNGPHVARISVFET  156 (608)
Q Consensus        77 ~~~~~~~t~v~~~l~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~tlnP~wne~~~~~ve~~~~~~l~~~v~D~  156 (608)
                      .|++++||.+.+                                      +|+||+||++.++.++.++..-.++.||||
T Consensus        77 ~g~~~f~t~~~~--------------------------------------~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  118 (644)
T PLN02964         77 FGEQTFRTETSD--------------------------------------STDKPVWNSEKKLLLEKNGPHLARISVFET  118 (644)
T ss_pred             ecceeeeecccc--------------------------------------ccCCcccchhhceEeccCCcceEEEEEEec
Confidence            999999999999                                      999999999999999888666679999999


Q ss_pred             cccccCCcCcceeeecccccccCcchh-hhhhhccCCCCCchhhHHHHhhcCCCCChhhhHHHHHHHhcccccCCCCccc
Q 007303          157 NRLSKSNLEGYCEVDLLEFLTKDSDAD-SEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLS  235 (608)
Q Consensus       157 D~~s~~D~iG~~~i~l~elLs~ee~~~-~eiF~~~D~d~dGkIl~ell~~l~~~~~~~~e~~~l~~~f~~~D~d~dG~Is  235 (608)
                      ++++.+|++|.+++++.++..+ +..+ .+.|+.+|++++|++++.++..++...|++.+..+++++|+.+|.|++|.|+
T Consensus       119 ~~~s~n~lv~~~e~~~t~f~~k-qi~elkeaF~lfD~dgdG~iLg~ilrslG~~~pte~e~~fi~~mf~~~D~DgdG~Id  197 (644)
T PLN02964        119 NRLSKNTLVGYCELDLFDFVTQ-EPESACESFDLLDPSSSNKVVGSIFVSCSIEDPVETERSFARRILAIVDYDEDGQLS  197 (644)
T ss_pred             CCCCHHHhhhheeecHhhccHH-HHHHHHHHHHHHCCCCCCcCHHHHHHHhCCCCCCHHHHHHHHHHHHHhCCCCCCeEc
Confidence            9999999999999999996654 4445 8899999999999999999999874477777777899999999999999999


Q ss_pred             HHHHHHHHHHhcCcccHHHHHHHHHHhcCCCCcccCHHHHHHHHHhhcccCcccCCchhHHHhHhhhcccCccccccccc
Q 007303          236 FKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCF  315 (608)
Q Consensus       236 ~eEf~~~l~~lg~~~~~eel~~~F~~~D~d~dG~Is~eEf~~~l~~~~e~~~~~~~~~~~~~~l~~~D~~~di~h~a~c~  315 (608)
                      ++||..++..++...++++++++|+.+|+|++|+|+++||.+++..+.+..+.+..||+|.+.++..|+.++|+|+|+|+
T Consensus       198 fdEFl~lL~~lg~~~seEEL~eaFk~fDkDgdG~Is~dEL~~vL~~~~~~~~~~~~cp~cg~~l~~~~~~~~iiH~~~c~  277 (644)
T PLN02964        198 FSEFSDLIKAFGNLVAANKKEELFKAADLNGDGVVTIDELAALLALQQEQEPIINNCPVCGEALGVSDKLNAMIHMTLCF  277 (644)
T ss_pred             HHHHHHHHHHhccCCCHHHHHHHHHHhCCCCCCcCCHHHHHHHHHhcccCcchhhhchhhcCcccchhhHHHHHHHHHhh
Confidence            99999999998888889999999999999999999999999999998888899999999999999999999999999999


Q ss_pred             ccCCcceeeeccccccchhhHHHHHHhhccccccccccCCCCCCce-EEEEEeccCCceeeeeehhhhhhhhhhhhcccc
Q 007303          316 DEGTGNQVMTGGFLTDKQASNVWMFKLSEWGHFSSYDVGLNSGSRA-HILVFDRRTKRLVEELIDVKIVMSMRAIYQSKI  394 (608)
Q Consensus       316 ~~~~~~~~~~~gfv~~~~A~~kw~~k~l~~~~~~~y~~~~~~~~~~-~i~~~~r~~~~~~~e~~~~~~~~~~~~~y~~~~  394 (608)
                      ||++++++|++||+|++||+++|++|+++|++||+|++|++.|+++ +|+|+||.||+++||++++++.++|+|+|++++
T Consensus       278 ~~~~~~~~~~~~~~~~~~a~~~w~~~~~~~~~~~~y~~g~~~~~~~~~i~~~dR~t~~~~~E~v~~~~~~~~~~lY~~~~  357 (644)
T PLN02964        278 DEGTGNQVMTGGFLTDKQASYGWMFKLSEWAHLSTYDVGLNTGSSASHILVFDRKSKRLVEELIDSKIVLSMRAIYQSKI  357 (644)
T ss_pred             cccccceeeccCccchhHHhHHHHHHHHHHHhccccccccccCCCcCceEEEECCCCcEEEEEeeeeehhhHHHHhcCch
Confidence            9999999999999999999999999999999999999999988887 999999999999999999999999999999999


Q ss_pred             cccccchhHHHHHHHHHHHHHHhhCCccccccHHHHHHHhccCCCccccCCCCCCcCCHHHHhccccCCCCccCCCCCCC
Q 007303          395 GLGLMDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFIRELKPGARPIDCMERE  474 (608)
Q Consensus       395 g~~~l~~~~~~~l~~~s~~~g~~~~s~~S~~~I~~fi~~~~~~i~~~e~~~p~~~y~sfn~FF~R~lk~~~Rpi~~~~~~  474 (608)
                      |+.+|++.++++|+.+|+++|+++|||+|+..|++||+.|+++|||+|+++|+++|+||||||+|+|||++|||+.++++
T Consensus       358 G~~~l~~~~~~~l~~~S~~~G~~~dsp~S~~~I~~Fi~~~~~~id~~E~~~p~~~y~SfNdFFtRkLKp~aRPi~~~~~~  437 (644)
T PLN02964        358 GLRLMDQGAKEILQRLSEKQGKKMNSVESAQDIPKFLEFFKDQINMDEVKYPLEHFKTFNEFFIRELKPGARPIACMDND  437 (644)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHhHcCChhhHHHHHHHHHHhhcCcCHHHhhcCcccCCCHHHcceecCCCCCCCCCCCCCC
Confidence            99999999999999999999999999999999999999987789999999999999999999999999999999998889


Q ss_pred             ceeeecCCceeeeeeeccCCceEEEcCcccchhcccCCCccccCcCCCeEEEEEeCCCCceeeecccCeEEeEEEEecCc
Q 007303          475 EVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNSFLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGC  554 (608)
Q Consensus       475 ~~~vsPaDg~~~~~~~i~~~~~~~iKg~~ysl~~lL~~~~~a~~f~~G~~~~~~Lsp~dYHR~h~P~~g~v~~~~~i~G~  554 (608)
                      .++||||||++.+|+.|+++..|||||++|||.+|||++.+|++|.||+++++||||+||||||+|++|+|.+.++|||+
T Consensus       438 ~~iVSPaDg~v~~~~~i~~~~~~~IKG~~Ysl~~LLg~~~~a~~f~gG~~~i~rLsP~DYHR~HsPv~G~v~~~~~I~G~  517 (644)
T PLN02964        438 DVAVCAADCRLMAFQSVDDSTRFWIKGRKFSIKGLLGKKVHSDAFLDGSLVIFRLAPQDYHRFHVPVSGVIEKFVDVPGS  517 (644)
T ss_pred             CEEEECCCceeEEeeeecCCcEEEECCCcccHHHHcCCchhHHhcCCCEEEEEEECCceeceeecCCCCEEEEEEEECCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccChhhhcccCCCCccceeEEEEEEeecCeeeEEEEecccccccccc
Q 007303          555 LYTVNPIAVNSKYCNVFTENKRVVSIISTAHFGKVCHYSRSHSHSHSRF  603 (608)
Q Consensus       555 ~~~v~p~~~~~~~~~~f~~N~R~~~~~~t~~~G~v~~v~VGa~~vg~~~  603 (608)
                      ||||||+|++..++++|++|+|++++++|+++|+|++|+|||++||+|.
T Consensus       518 l~sVnp~al~~~~~~~f~~NeR~v~~iet~~~G~V~~v~VGA~~VgsI~  566 (644)
T PLN02964        518 LYTVNPIAVNSKYCNVFTENKRAVCIISTAEFGKVAFVAIGATMVGSIT  566 (644)
T ss_pred             eEecChhhhcccccchhhcCeeEEEEEEcCCCCEEEEEEEeeeEeeEEE
Confidence            9999999997656899999999999999999999999999999999985

>KOG2419 consensus Phosphatidylserine decarboxylase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00723 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PTZ00403 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PLN02938 phosphatidylserine decarboxylase Back     alignment and domain information
>PRK03140 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK00044 psd phosphatidylserine decarboxylase; Reviewed Back     alignment and domain information
>PRK03934 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>TIGR00163 PS_decarb phosphatidylserine decarboxylase precursor Back     alignment and domain information
>PF02666 PS_Dcarbxylase: Phosphatidylserine decarboxylase; InterPro: IPR003817 Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria Back     alignment and domain information
>KOG2420 consensus Phosphatidylserine decarboxylase [Lipid transport and metabolism] Back     alignment and domain information
>COG0688 Psd Phosphatidylserine decarboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF12588 PSDC: Phophatidylserine decarboxylase ; InterPro: IPR022237 This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query608
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-11
2hps_A186 Coelenterazine-binding protein with bound coelent; 9e-09
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 7e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-08
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-04
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 3e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-05
3akb_A166 Putative calcium binding protein; EF-hand, metal b 9e-08
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-07
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-06
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 5e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 5e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 6e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 8e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-04
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 9e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-06
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 1e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 1e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 6e-04
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-06
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 2e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 3e-06
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-06
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 4e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-06
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 6e-06
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 6e-06
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 7e-06
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-05
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 1e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-05
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 1e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-05
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 2e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 8e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-05
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 3e-05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 3e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 3e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 4e-05
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 5e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 7e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 9e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 4e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 9e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-04
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-04
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-04
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-04
1y1x_A191 Leishmania major homolog of programmed cell death 2e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 6e-04
3fwb_A161 Cell division control protein 31; gene gating, com 6e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 7e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 8e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 8e-04
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
 Score = 58.3 bits (142), Expect = 3e-11
 Identities = 14/61 (22%), Positives = 27/61 (44%)

Query: 220 RRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAALL 279
             +   +D N DG +S++E    +S           + +FK+ D +G+G +  +E A   
Sbjct: 3   EALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFY 62

Query: 280 A 280
            
Sbjct: 63  G 63
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query608
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.38
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.37
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.36
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.35
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.35
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.34
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.34
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.33
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.32
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.3
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.26
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.26
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.25
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.24
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.24
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.23
3fwb_A161 Cell division control protein 31; gene gating, com 99.23
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.23
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.22
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.22
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.21
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.2
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.2
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.2
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.19
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.19
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.18
3fwb_A161 Cell division control protein 31; gene gating, com 99.18
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.18
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.17
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.17
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.16
1y1x_A191 Leishmania major homolog of programmed cell death 99.16
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.16
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.16
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.16
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.16
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.15
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.15
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.15
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.15
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.14
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.14
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.13
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.13
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.13
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.13
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.13
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.12
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.12
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.12
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.12
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.11
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.11
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.11
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.11
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.1
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.1
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.1
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.1
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.1
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.1
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.1
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.1
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.1
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.09
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.09
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.09
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.09
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.09
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.08
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.08
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.08
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.08
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.08
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.08
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.08
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.08
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.08
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.07
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.07
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.07
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.06
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.06
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.06
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.05
1y1x_A191 Leishmania major homolog of programmed cell death 99.05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.03
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.03
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.03
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.03
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.03
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.03
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.03
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.02
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.02
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.02
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.02
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.02
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.02
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.02
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.02
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.01
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.01
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.01
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.01
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.01
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.01
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.0
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.0
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.0
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.0
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.99
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 98.99
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.98
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.98
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.98
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.98
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.98
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.98
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.98
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 98.98
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.97
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.97
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.97
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.97
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.97
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.97
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.97
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.97
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.96
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 98.96
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 98.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.96
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.96
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.96
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 98.96
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 98.95
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.95
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.95
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 98.95
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.95
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.95
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.95
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.95
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.94
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.94
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.94
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 98.94
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.94
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 98.94
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.94
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 98.94
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.94
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.93
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.93
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.93
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.93
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.93
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 98.93
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.93
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 98.92
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.92
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 98.92
3li6_A66 Calcium-binding protein; calcium signaling protein 98.92
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 98.91
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.91
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.9
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.9
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.89
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.89
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 98.89
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 98.89
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.89
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.89
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.88
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 98.88
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.88
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.88
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.87
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.87
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.87
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.87
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.87
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 98.87
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.86
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.86
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.86
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 98.85
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.85
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.84
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.84
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.84
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 98.83
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.83
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.83
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.83
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 98.82
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.82
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.82
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.81
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.81
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.8
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.8
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.79
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.79
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.78
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.78
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.78
3nsj_A540 Perforin-1; pore forming protein, immune system; H 98.77
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.76
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.75
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.75
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.74
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.73
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.73
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.73
1c07_A95 Protein (epidermal growth factor receptor pathway 98.73
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.72
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.72
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.71
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.7
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.69
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.69
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.68
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.68
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.68
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.68
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.68
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 98.67
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.67
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.66
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.66
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.66
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 98.66
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.66
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.64
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.64
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.63
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.63
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.63
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.62
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.62
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.62
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.61
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.6
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.6
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.6
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.59
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.59
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.58
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.55
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.53
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 98.52
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.52
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.51
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.51
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.51
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.49
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.46
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.46
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.46
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.45
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.44
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 98.42
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.4
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.39
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.39
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.37
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 98.36
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.27
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.27
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.24
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.22
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.22
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.21
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.18
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.16
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.11
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.11
3bxj_A483 RAS GTPase-activating protein syngap; GTPase activ 98.11
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.1
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.01
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.01
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.94
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.83
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.8
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.8
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 97.79
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.79
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 97.78
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 97.73
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 97.72
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 97.71
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 97.71
1avs_A90 Troponin C; muscle contraction, calcium-activated, 97.7
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.7
1c07_A95 Protein (epidermal growth factor receptor pathway 97.7
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.65
1qjt_A99 EH1, epidermal growth factor receptor substrate su 97.65
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.64
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.63
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.62
3li6_A66 Calcium-binding protein; calcium signaling protein 97.59
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 97.58
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.58
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.58
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.54
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 97.53
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.53
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.51
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 97.51
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.5
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 97.46
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.41
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 97.39
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 97.39
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.35
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.35
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 97.33
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 97.29
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.28
2jq6_A139 EH domain-containing protein 1; metal binding prot 97.27
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.24
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.23
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 97.22
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.22
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.17
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.14
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.08
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.07
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.02
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.0
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 96.99
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 96.6
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 96.58
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 95.64
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.47
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.2
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 94.74
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 94.74
2gpr_A154 Glucose-permease IIA component; phosphotransferase 94.74
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 94.41
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 94.14
1nub_A229 Basement membrane protein BM-40; extracellular mod 90.95
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 90.01
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 86.64
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 82.59
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 80.22
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 80.07
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
Probab=99.38  E-value=1.1e-12  Score=119.62  Aligned_cols=117  Identities=20%  Similarity=0.293  Sum_probs=92.7

Q ss_pred             hhhhhccCCCCCchh----hHHHHhhcCCCCChhhhHHHHHHHhcccccCCCCcccHHHHHHHHHHh-cCcccHHHHHHH
Q 007303          184 SEVFDLLDPSSSNKI----VGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAF-GNQVAANKKEEL  258 (608)
Q Consensus       184 ~eiF~~~D~d~dGkI----l~ell~~l~~~~~~~~e~~~l~~~f~~~D~d~dG~Is~eEf~~~l~~l-g~~~~~eel~~~  258 (608)
                      .++|..+|.+++|.|    +..++..++. .++..+   +..+++.+|.|++|.|+++||..++... ....+.++++.+
T Consensus         9 ~~~F~~~D~d~~G~I~~~el~~~l~~~g~-~~~~~~---~~~~~~~~d~~~~g~i~~~eF~~~~~~~~~~~~~~~~l~~~   84 (143)
T 2obh_A            9 REAFDLFDADGTGTIDVKELKVAMRALGF-EPKKEE---IKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKA   84 (143)
T ss_dssp             HHHHHTTCTTCCSEEEGGGHHHHHHHTTC-CCCHHH---HHHHHHHHTTTCCSEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhCCCCCCcCcHHHHHHHHHHcCC-CCCHHH---HHHHHHHhCCCCCCeeeHHHHHHHHHHHhccccHHHHHHHH
Confidence            678999999999998    6666777654 555555   8889999999999999999999887652 223345678999


Q ss_pred             HHHhcCCCCcccCHHHHHHHHHhhcccCcccCCchhHHHhHhhhcccCcc
Q 007303          259 FKAADKNGDGVVSVDELAALLALQQEKEPLMNCCPVCGETLEVADMVNTM  308 (608)
Q Consensus       259 F~~~D~d~dG~Is~eEf~~~l~~~~e~~~~~~~~~~~~~~l~~~D~~~di  308 (608)
                      |+.+|+|++|+|+.+||.+++..++...+.    ..+.+++...|.+++.
T Consensus        85 F~~~D~d~~G~I~~~el~~~l~~~g~~~~~----~~~~~~~~~~D~d~dG  130 (143)
T 2obh_A           85 FKLFDDDETGKISFKNLKRVAKELGENLTD----EELQEMIDEADRDGDG  130 (143)
T ss_dssp             HHHHCTTCSSSBCHHHHHHHHHHTTCCCCH----HHHHHHHHHHCTTSSS
T ss_pred             HHHhCCCCCCcCcHHHHHHHHHHhCCCCCH----HHHHHHHHHhCCCCCC
Confidence            999999999999999999999887765544    5688888888877665
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 608
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-08
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-05
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 5e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 8e-06
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-05
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 0.002
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 5e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 5e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 9e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 1e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 2e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 2e-04
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 2e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 6e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.003
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.001
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 0.001
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 0.001
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.002
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.002
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.002
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 0.003
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.003
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin-related protein T21P5.17
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 48.8 bits (116), Expect = 3e-08
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 217 SFARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELA 276
           S A+R+    D N+DG+LS  EF ++  AF          + F+  D +G+G ++ DE  
Sbjct: 1   SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFT 60

Query: 277 ALL 279
           + +
Sbjct: 61  SCI 63
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query608
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.25
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.23
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.21
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.2
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.17
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.17
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.15
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.12
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.11
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.11
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.09
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.09
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.08
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.08
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.07
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.07
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.06
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.06
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.05
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.05
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.05
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.05
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.04
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.03
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.02
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.02
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.02
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.01
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.01
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.0
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.0
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.0
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.0
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.0
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.0
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.99
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.99
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.99
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.98
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.98
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.98
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.98
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.97
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.96
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.95
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 98.94
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.93
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.92
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 98.92
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.91
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.91
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 98.91
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.9
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.89
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.88
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.88
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.87
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 98.85
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.83
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.82
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.82
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.81
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.81
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.81
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.8
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.8
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.79
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.79
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.79
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.79
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 98.78
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 98.78
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 98.77
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.75
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.75
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.74
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.74
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.73
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 98.73
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.73
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.71
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.71
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.71
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.71
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.68
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.67
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.63
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.62
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.62
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.61
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.61
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 98.56
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.55
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.53
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.53
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.52
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.51
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.51
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.5
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.5
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.48
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.46
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 98.46
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.45
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.45
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.45
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.4
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.38
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.34
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.32
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.28
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.28
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.28
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.25
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.23
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.22
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 98.22
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.21
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.21
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.2
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.19
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.17
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.17
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.12
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.12
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.11
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.1
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.1
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.09
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.08
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.08
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.06
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.04
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.04
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 97.99
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.91
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.87
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.7
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.63
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.61
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.58
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.53
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.48
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.47
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.31
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.29
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 97.28
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.12
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.04
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 96.99
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 96.96
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 96.95
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 96.84
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 96.84
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 96.78
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 96.72
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.69
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 96.5
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 95.81
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.72
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.87
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 92.95
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 92.41
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 90.28
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 89.45
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.56
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 88.52
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 86.64
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 86.15
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Parvalbumin
domain: Parvalbumin
species: Leopard shark (Triakis semifasciata) [TaxId: 30493]

Probab=99.25  E-value=5.5e-12  Score=108.55  Aligned_cols=93  Identities=17%  Similarity=0.399  Sum_probs=75.8

Q ss_pred             hhhhhccCCCCCchh-hHHHHhhcCCCCChhhhHHHHHHHhcccccCCCCcccHHHHHHHHHHh---cCcccHHHHHHHH
Q 007303          184 SEVFDLLDPSSSNKI-VGKISLSCSVEDPIETEKSFARRILSIVDYNQDGQLSFKEFSDLISAF---GNQVAANKKEELF  259 (608)
Q Consensus       184 ~eiF~~~D~d~dGkI-l~ell~~l~~~~~~~~e~~~l~~~f~~~D~d~dG~Is~eEf~~~l~~l---g~~~~~eel~~~F  259 (608)
                      .+++..++  .+|.| +.+++..+.....++++   ++++|+.+|.|++|+|+.+||..++..+   |..+++++++++|
T Consensus        12 ~~~~~~~~--~~G~idf~eF~~~~~~~~~~~~~---l~~~F~~~D~d~~G~I~~~El~~~l~~l~~~g~~~~~~e~~~~~   86 (109)
T d5pala_          12 NKAISAFK--DPGTFDYKRFFHLVGLKGKTDAQ---VKEVFEILDKDQSGFIEEEELKGVLKGFSAHGRDLNDTETKALL   86 (109)
T ss_dssp             HHHHHHTC--STTCCCHHHHHHHHTCTTCCHHH---HHHHHHHHCTTCSSEECHHHHHTHHHHHCTTCCCCCHHHHHHHH
T ss_pred             HHHHHhcC--CCCcCcHHHHHHHHHhcCCCHHH---HHHHHhhhcCCCCCeEcHHHHHHHHHHhhhccCcCCHHHHHHHH
Confidence            34455444  45778 88887666433333334   8999999999999999999999998875   6678999999999


Q ss_pred             HHhcCCCCcccCHHHHHHHHHh
Q 007303          260 KAADKNGDGVVSVDELAALLAL  281 (608)
Q Consensus       260 ~~~D~d~dG~Is~eEf~~~l~~  281 (608)
                      +.+|.|+||.|+|+||.+++.+
T Consensus        87 ~~~D~d~dG~I~~~EF~~~m~~  108 (109)
T d5pala_          87 AAGDSDHDGKIGADEFAKMVAQ  108 (109)
T ss_dssp             HHHCTTCSSSEEHHHHHHHHHH
T ss_pred             HHhCCCCCCCEeHHHHHHHHHh
Confidence            9999999999999999999864
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure