Citrus Sinensis ID: 007324

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61

MASWLKAAEDLFEVVDRRAKLVVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPVDVTPNKDTATLAVEKETITTGKTQKNGEQQQTNERDAPSIPLTEQSKDMSKHDADRVEIPETFTDLDTATPNGEILNENDSDVHLNHPPSPLPPKEMGIVNEDRIDDAGQITKSADADAPLKIDSKIQAVDPPVNSESSLKDADVKVETLSNKRKQQALKADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVCAGLSSRLQEYKSENAQLEELLVAERELSRSYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQALREELASVERRAEEERAAHNATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDAEHYSREEHMELEKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQEVQVCQRVLHSTPIEVVIYILH

ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccccccHcccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcc

***WLKAAEDLFEVVDRRAKLVVN************************************************************************************************************************************************************************************************************************************************************VCA********************************************************************************************************************************************************************************AMLEVECA**************************************************************************************YRELTDLLYYKQTQL*****************MNRLQEVQVCQRVLHSTPIEVVIYILH

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASWLKAAEDLFEVVDRRAKLVVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPVDVTPNKDTATLAVEKETITTGKTQKNGEQQQTNERDAPSIPLTEQSKDMSKHDADRVEIPETFTDLDTATPNGEILNENDSDVHLNHPPSPLPPKEMGIVNEDRIDDAGQITKSADADAPLKIDSKIQAVDPPVNSESSLKDADVKVETLSNKRKQQALKADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMxxxxxxxxxxxxxxxxxxxxxHNATKMAAMEREVELEHRAAEASMALARIQRIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSPEEANQAIQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEHMELEKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQEVQVCQRVLHSTPIEVVIYILH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Golgin candidate 1	Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.	probable	Q8S8N9
Golgin-84	May be involved in maintaining Golgi structure and in intra-Golgi transport.	probable	Q5JLY8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 499-554
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 280-321
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:confident
Coverage over the Query: 248-265,277-376,387-411
View the alignment between query and template
View the model in PyMOL

Template: 2FXO, chain A
Confidence level:confident
Coverage over the Query: 338-405,417-474
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 437-475,487-559
View the alignment between query and template
View the model in PyMOL

Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 204-593
View the alignment between query and template
View the model in PyMOL