Citrus Sinensis ID: 007331

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------
MDNNVKSGGVGGEEGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQASNKNNNCGSSSGININSNTKSTQGLPTVSESPTAVNRVSFESLKRRHSNSTNNNYKDSPQKDSEGEVVKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPERIEPKSGRVVGRSGQLKSGFIGKNVDEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGVTIPPGLKSSVLSSPQSAKVIGSGRLQRTPREGKSPKLSHTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc
cccccccccccccccHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHcccccccccHcHHcccccccccccccccccccccccccccccccccccccccEcHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccEEEHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccc
mdnnvksggvggeegfdfmqhgpsmedppsvlIGQFlhkqkasgeisldMDLEMDELQHQasnknnncgsssgininsntkstqglptvsesptavnrvSFESLKrrhsnstnnnykdspqkdsegevvkctsnksfdrnvsfnKKSALLMTKTKsrlmdlpperiepksgrvvgrsgqlksgfigknvdeeeedplleedlpeeykkEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIetlsgpplieiQKAEEEQERIVSEVQKLqnagvtippglkssvlsspqsakvigsgrlqrtpregkspklshtfsnkdddgitidhlhklnpknvsAWNMKRLMNIIrhgslttldeqiqdstnedesaphiKTEYEAKAAARKIFQNvakpgskfiYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
mdnnvksggvggEEGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQASNKNNNCGSSSGININSNTKSTqglptvsesptaVNRVSfeslkrrhsnstnnnykdspqkdsegevVKCTsnksfdrnvsfnkksallmtktksrlmdlpperiepksgrvvgrsgqlksgfigknvdeeeedplleedlpeeyKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQnagvtippglkssvlsspqsakvigsgrlqrtpregkspklshtfsnkdddgitIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQdstnedesaphIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEaserkkisksalknWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
MDNNVKSGGVGGEEGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQAsnknnncgsssgininsntkstQGLPTVSESPTAVNRVSFESLKRRHSNSTNNNYKDSPQKDSEGEVVKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPERIEPKSGRVVGRSGQLKSGFIGKNVdeeeedplleedlpeeYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFkkkklwklglwkwellilvlICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGvmlwlvktllvkvlASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGVTIPPGLKSSVLSSPQSAKVIGSGRLQRTPREGKSPKLSHTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
****************************************************************************************************************************************************************************************************************EKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEI**********************************************************************ITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTT**************************AARKIFQNVAKPGSKFIYLEDLMRFLN***********************ALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENF***
****************************************************************************************************************************************************************************************************LLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLI*********************************************************************************************LMNIIRHGSLT*********************EYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
********GVGGEEGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQASNKNNNCGSSSGININSNTKSTQGLPTVSESPTAVNRVSFESL************************VKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPERIEPKSGRVVGRSGQLKSGFIGKNVDEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGVTIPPGLKS******************************HTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQI**********PHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMS************KSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
*************************EDPPSVLIGQFLHKQKASGEISLDMD***********************************************************************************************************************************************DPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQN*************************************************DGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNNVKSGGVGGEEGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQASNKNNNCGSSSGININSNTKSTQGLPTVSESPTAVNRVSFESLKRRHSNSTNNNYKDSPQKDSEGEVVKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPERIEPKSGRVVGRSGQLKSGFIGKNVDEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIExxxxxxxxxxxxxxxxxxxxxGVTIPPGLKSSVLSSPQSAKVIGSGRLQRTPREGKSPKLSHTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQRMAFSMRVDITKSLFLAIYCLLEENFKLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query607 2.2.26 [Sep-21-2011]
Q9SYM1 856 Mechanosensitive ion chan yes no 0.864 0.613 0.571 1e-174
Q9LH74 881 Mechanosensitive ion chan no no 0.884 0.609 0.537 1e-167
Q9LPG3 881 Mechanosensitive ion chan no no 0.930 0.641 0.519 1e-161
F4IME2 908 Mechanosensitive ion chan no no 0.899 0.601 0.524 1e-158
F4IME1 849 Mechanosensitive ion chan no no 0.831 0.594 0.497 1e-133
Q9LYG9 734 Mechanosensitive ion chan no no 0.710 0.587 0.338 2e-67
Q84M97 742 Mechanosensitive ion chan no no 0.525 0.429 0.368 4e-60
>sp|Q9SYM1|MSL6_ARATH Mechanosensitive ion channel protein 6 OS=Arabidopsis thaliana GN=MSL6 PE=1 SV=1 Back     alignment and function desciption
 Score =  613 bits (1580), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 347/607 (57%), Positives = 421/607 (69%), Gaps = 82/607 (13%)

Query: 6   KSGGVGGE----EGFDFMQHGPSMEDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQA 61
           +S    GE    EGF+F +     EDPP+ LIGQFLHKQ+ASGEI LDMDL MDELQ   
Sbjct: 62  RSAATTGEQQKDEGFEFRRG----EDPPTKLIGQFLHKQQASGEICLDMDLGMDELQ--- 114

Query: 62  SNKNNNCGSSSGININSNTKSTQGLPTVSESPTAVNRVSF--ESLKRRHSNSTNNNYKDS 119
                                ++GL  VSESP    RVS   + + RR S S  NN  D 
Sbjct: 115 ---------------------SRGLTPVSESP----RVSTKRDPVGRRDSRSNTNNNDD- 148

Query: 120 PQKDSEGEVVKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPER-----IEPKSGRVV 174
                 GEVVKC+ N +  +  S    S LL  +T+SRL D P  +      + KSGR+ 
Sbjct: 149 ------GEVVKCSGNNAPIQRSS----STLLKMRTRSRLSDPPTPQLPPQTADMKSGRI- 197

Query: 175 GRSGQLKSGFIGKNV----DEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALV 230
            +SGQ+KSGF GK+     +EEE+DP   EDLPEEY+K+K+S+W++LEW SLILII   V
Sbjct: 198 PKSGQMKSGFFGKSPKTQGEEEEDDPFAAEDLPEEYRKDKLSLWIVLEWLSLILIIAGFV 257

Query: 231 CSLTIDYFKKKKLWKLGLWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFV 290
           C+L I   +KKKLW+L LWKWE ++LVLICGRLVSSWIV+I+VF IERNFLLRKRVLYFV
Sbjct: 258 CTLAIPSLRKKKLWELQLWKWESMVLVLICGRLVSSWIVKIVVFFIERNFLLRKRVLYFV 317

Query: 291 YGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLL 350
           YGVRKAVQNCLWLGLVL+AWH LFD++V +  N+  L+  TKI +CL VG +LWLVKTLL
Sbjct: 318 YGVRKAVQNCLWLGLVLLAWHFLFDEKVAKAANTKALRVVTKIFVCLLVGFLLWLVKTLL 377

Query: 351 VKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGV 410
           VKVLASSFH+STYFDRIQE+LF QY+IETLSGPPLIEIQK EEE+ERI  EV+K QN G 
Sbjct: 378 VKVLASSFHMSTYFDRIQESLFTQYVIETLSGPPLIEIQKNEEEEERISVEVKKFQNPG- 436

Query: 411 TIPPGLKSSVLSSPQSAKVIGSGRLQRTPREGKSPKLSHTFSN-----KDDDGITIDHLH 465
               G++            I SG  +   + GKSP LSH  SN      ++ GITID LH
Sbjct: 437 ----GVE------------IQSGAQKSPMKTGKSPFLSHVLSNGGGGGGENKGITIDSLH 480

Query: 466 KLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQN 525
           KLNPKNVSAW MKRLMNIIR+GSLTTLDEQ+QD + +D+    I++E+EAK AARKIF N
Sbjct: 481 KLNPKNVSAWKMKRLMNIIRNGSLTTLDEQLQDPSLDDDKGNQIRSEFEAKLAARKIFHN 540

Query: 526 VAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIW-QRMAFSM 584
           VAKPGSKFIY  D+MRFL +DEA KT+SLFE ASE  +ISKS+LKNWVV  + +R A ++
Sbjct: 541 VAKPGSKFIYANDIMRFLPDDEALKTLSLFEGASETNRISKSSLKNWVVNAFRERRALAL 600

Query: 585 RVDITKS 591
            ++ TK+
Sbjct: 601 TLNDTKT 607
Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LH74|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPG3|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana GN=MSL4 PE=3 SV=1 Back     alignment and function description
>sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 Back     alignment and function description
>sp|F4IME1|MSL7_ARATH Mechanosensitive ion channel protein 7 OS=Arabidopsis thaliana GN=MSL7 PE=3 SV=1 Back     alignment and function description
>sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 Back     alignment and function description
>sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
255567130 709 conserved hypothetical protein [Ricinus 0.886 0.758 0.651 0.0
449526483 923 PREDICTED: mechanosensitive ion channel 0.927 0.609 0.603 0.0
449444568 923 PREDICTED: mechanosensitive ion channel 0.927 0.609 0.601 0.0
357444799 926 mscS family protein, putative [Medicago 0.940 0.616 0.562 0.0
356575442 870 PREDICTED: uncharacterized mscS family p 0.906 0.632 0.561 1e-176
356575444 868 PREDICTED: uncharacterized mscS family p 0.891 0.623 0.571 1e-175
15218429 856 mechanosensitive channel of small conduc 0.864 0.613 0.571 1e-173
449454364 955 PREDICTED: mechanosensitive ion channel 0.912 0.580 0.536 1e-171
147841852 922 hypothetical protein VITISV_039348 [Viti 0.945 0.622 0.562 1e-168
255560445 882 conserved hypothetical protein [Ricinus 0.934 0.642 0.545 1e-168
>gi|255567130|ref|XP_002524547.1| conserved hypothetical protein [Ricinus communis] gi|223536221|gb|EEF37874.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/589 (65%), Positives = 467/589 (79%), Gaps = 51/589 (8%)

Query: 26  EDPPSVLIGQFLHKQKASGEISLDMDLEMDELQHQASNKNNNCGSSSGININSNTKSTQG 85
           EDPPS LIGQFLHKQ+ASGE  LDMD+EM ELQ+               N+  N      
Sbjct: 2   EDPPSKLIGQFLHKQQASGEFCLDMDMEMAELQN---------------NVYKN------ 40

Query: 86  LPTVSESPTAVNRVSF-------ESLKRRHSNSTNNNYKDSPQKDS-----EGEVVKCTS 133
           L  +SESP+ VNRVSF       E+++RR+       +KDSP K S     +GE++KC+S
Sbjct: 41  LGPISESPSTVNRVSFDPHGSNNEAVRRRY------QHKDSPSKKSTDSTADGEILKCSS 94

Query: 134 --NKSFDRNVSFNK-KSALLMTKTKSRLMDLPPERIEP-KSGRVVGRSGQLKSGFIGKN- 188
             + +F  + SF + KS+LL  + KSRLMD PP +  P KSGRV+GRSGQL+SGF+GK  
Sbjct: 95  RNDVTFSNSSSFKQHKSSLLKERPKSRLMDPPPPQQHPGKSGRVLGRSGQLRSGFVGKGS 154

Query: 189 -VDEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLG 247
            +D+EE+DPLLEEDLPEE+KK+K+ IWVLL+W SLILII ALVCSL   YF+ K LW+L 
Sbjct: 155 VIDDEEDDPLLEEDLPEEFKKDKLDIWVLLQWVSLILIIAALVCSLVSSYFRNKSLWRLS 214

Query: 248 LWKWELLILVLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVL 307
           LWKWE+ +LVLICGRLVS W++RIIVF IERNFLLRKRVLYFVYG++KAVQNCLWLGLVL
Sbjct: 215 LWKWEVFVLVLICGRLVSGWVIRIIVFFIERNFLLRKRVLYFVYGIKKAVQNCLWLGLVL 274

Query: 308 IAWHCLFDQRVERETNSDVLKYATKILICLWVGVMLWLVKTLLVKVLASSFHVSTYFDRI 367
           IAWH LFD++VERET S  L+Y TK+L+CL +G +LWLVKTL+VKVLASSFHVSTYFDRI
Sbjct: 275 IAWHFLFDKKVERETKSKTLRYVTKVLMCLLLGTLLWLVKTLVVKVLASSFHVSTYFDRI 334

Query: 368 QEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGVTIPPGLKSSVLSSPQSA 427
           QE+LFNQY+IETLSGPPLIEI++ EEE+ERI +EV KLQNAG T+PPGLK +  +SPQ  
Sbjct: 335 QESLFNQYVIETLSGPPLIEIKRNEEEEERIAAEVLKLQNAGATVPPGLKPNTCTSPQGT 394

Query: 428 KVIGSGRLQRTPREGKSPKLSHTFS---NKDDDGITIDHLHKLNPKNVSAWNMKRLMNII 484
           KVIGSGR+Q++PR G +P++S  FS   N++DDGITIDHLHKLNPKNVSAWNMKRLMNII
Sbjct: 395 KVIGSGRIQKSPRIG-TPRISRAFSKKANEEDDGITIDHLHKLNPKNVSAWNMKRLMNII 453

Query: 485 RHGSLTTLDEQIQDST-NEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFL 543
           R+G+L+TLDEQIQDS  +EDESA  IK+E+EAKAAARKIFQNVAKPGS++IYLED+MRF+
Sbjct: 454 RYGALSTLDEQIQDSAHDEDESATKIKSEFEAKAAARKIFQNVAKPGSRYIYLEDIMRFM 513

Query: 544 NEDEASKTMSLFEEASERKKISKSALKNWVVRIW-QRMAFSMRVDITKS 591
            EDEA K M+LFE ASE KKISKS LKNWVV  + +R A ++ ++ TK+
Sbjct: 514 QEDEALKAMTLFEGASESKKISKSCLKNWVVNAFRERRALALTLNDTKT 562

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449526483|ref|XP_004170243.1| PREDICTED: mechanosensitive ion channel protein 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444568|ref|XP_004140046.1| PREDICTED: mechanosensitive ion channel protein 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357444799|ref|XP_003592677.1| mscS family protein, putative [Medicago truncatula] gi|355481725|gb|AES62928.1| mscS family protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|356575442|ref|XP_003555850.1| PREDICTED: uncharacterized mscS family protein At1g78610-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356575444|ref|XP_003555851.1| PREDICTED: uncharacterized mscS family protein At1g78610-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|15218429|ref|NP_177982.1| mechanosensitive channel of small conductance-like 6 [Arabidopsis thaliana] gi|75213461|sp|Q9SYM1.1|MSL6_ARATH RecName: Full=Mechanosensitive ion channel protein 6; AltName: Full=Mechanosensitive channel of small conductance-like 6; AltName: Full=MscS-Like protein 6 gi|4836872|gb|AAD30575.1|AC007260_6 Hypothetical protein [Arabidopsis thaliana] gi|332198006|gb|AEE36127.1| mechanosensitive channel of small conductance-like 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449454364|ref|XP_004144925.1| PREDICTED: mechanosensitive ion channel protein 6-like [Cucumis sativus] gi|449529323|ref|XP_004171649.1| PREDICTED: mechanosensitive ion channel protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147841852|emb|CAN67321.1| hypothetical protein VITISV_039348 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560445|ref|XP_002521237.1| conserved hypothetical protein [Ricinus communis] gi|223539505|gb|EEF41093.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
TAIR|locus:2202965 856 MSL6 "mechanosensitive channel 0.787 0.558 0.521 1.2e-134
TAIR|locus:2099382 881 MSL5 "mechanosensitive channel 0.904 0.623 0.474 1.8e-126
TAIR|locus:2024927 881 MSL4 "mechanosensitive channel 0.932 0.642 0.473 2.9e-126
TAIR|locus:2827671 849 AT2G17000 "AT2G17000" [Arabido 0.739 0.528 0.494 2.9e-103
TAIR|locus:2180811 742 MSL9 "mechanosensitive channel 0.298 0.243 0.401 2.7e-44
TAIR|locus:2143069 734 MSL10 "mechanosensitive channe 0.365 0.302 0.361 7e-28
TAIR|locus:2010287149 AT1G49260 "AT1G49260" [Arabido 0.191 0.778 0.231 1.1e-05
TAIR|locus:2202965 MSL6 "mechanosensitive channel of small conductance-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1186 (422.6 bits), Expect = 1.2e-134, Sum P(2) = 1.2e-134
 Identities = 272/522 (52%), Positives = 334/522 (63%)

Query:    84 QGLPTVSESPTAVNRVSFESLKRRHSNSTNNNYKDSPQKDSEGEVVKCTSNKSFDRNVSF 143
             +GL  VSESP    +   + + RR S S  NN  D       GEVVKC+ N +  +  S 
Sbjct:   116 RGLTPVSESPRVSTKR--DPVGRRDSRSNTNNNDD-------GEVVKCSGNNAPIQRSS- 165

Query:   144 NKKSALLMTKTKSRLMD-----LPPERIEPKSGRVVGRSGQLKSGFIGKNVXXXXXXXXX 198
                S LL  +T+SRL D     LPP+  + KSGR+  +SGQ+KSGF GK+          
Sbjct:   166 ---STLLKMRTRSRLSDPPTPQLPPQTADMKSGRIP-KSGQMKSGFFGKSPKTQGEEEED 221

Query:   199 XXXXXXX----YKKEKISIWVLLEWFSLILIIGALVCSLTIDYFXXXXXXXXXXXXXXXX 254
                        Y+K+K+S+W++LEW SLILII   VC+L I                   
Sbjct:   222 DPFAAEDLPEEYRKDKLSLWIVLEWLSLILIIAGFVCTLAIPSLRKKKLWELQLWKWESM 281

Query:   255 XXXXICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLF 314
                 ICGRLVSSWIV+I+VF IERNFLLRKRVLYFVYGVRKAVQNCLWLGLVL+AWH LF
Sbjct:   282 VLVLICGRLVSSWIVKIVVFFIERNFLLRKRVLYFVYGVRKAVQNCLWLGLVLLAWHFLF 341

Query:   315 DQRVERETNSDVLKYATKILICLWVGXXXXXXXXXXXXXXASSFHVSTYFDRIQEALFNQ 374
             D++V +  N+  L+  TKI +CL VG              ASSFH+STYFDRIQE+LF Q
Sbjct:   342 DEKVAKAANTKALRVVTKIFVCLLVGFLLWLVKTLLVKVLASSFHMSTYFDRIQESLFTQ 401

Query:   375 YLIETLSGPPLIEIQKAEEEQERIVSEVQKLQN-AGVTIPPGLKSSVLS---SPQSAKVI 430
             Y+IETLSGPPLIEIQK EEE+ERI  EV+K QN  GV I  G + S +    SP  + V+
Sbjct:   402 YVIETLSGPPLIEIQKNEEEEERISVEVKKFQNPGGVEIQSGAQKSPMKTGKSPFLSHVL 461

Query:   431 GSGRLQRTPREGKSPKLSHTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLT 490
              +G        G   +      NK   GITID LHKLNPKNVSAW MKRLMNIIR+GSLT
Sbjct:   462 SNGG-------GGGGE------NK---GITIDSLHKLNPKNVSAWKMKRLMNIIRNGSLT 505

Query:   491 TLDEQIQDSTNEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASK 550
             TLDEQ+QD + +D+    I++E+EAK AARKIF NVAKPGSKFIY  D+MRFL +DEA K
Sbjct:   506 TLDEQLQDPSLDDDKGNQIRSEFEAKLAARKIFHNVAKPGSKFIYANDIMRFLPDDEALK 565

Query:   551 TMSLFEEASERKKISKSALKNWVVRIW-QRMAFSMRVDITKS 591
             T+SLFE ASE  +ISKS+LKNWVV  + +R A ++ ++ TK+
Sbjct:   566 TLSLFEGASETNRISKSSLKNWVVNAFRERRALALTLNDTKT 607
GO:0005634 "nucleus" evidence=ISM
GO:0016020 "membrane" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2099382 MSL5 "mechanosensitive channel of small conductance-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024927 MSL4 "mechanosensitive channel of small conductance-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827671 AT2G17000 "AT2G17000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180811 MSL9 "mechanosensitive channel of small conductance-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143069 MSL10 "mechanosensitive channel of small conductance-like 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010287 AT1G49260 "AT1G49260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SYM1MSL6_ARATHNo assigned EC number0.57160.86490.6133yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 607
KOG4629 714 consensus Predicted mechanosensitive ion channel [ 100.0
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 96.49
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 96.21
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 95.81
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.8
cd0005267 EH Eps15 homology domain; found in proteins implic 95.76
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 94.93
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 94.6
cd0021388 S-100 S-100: S-100 domain, which represents the la 94.38
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 94.27
PTZ00183158 centrin; Provisional 94.01
PTZ00184149 calmodulin; Provisional 93.65
PTZ00183158 centrin; Provisional 93.64
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 93.54
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 93.39
PRK12309391 transaldolase/EF-hand domain-containing protein; P 93.28
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 93.19
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 93.13
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 92.97
PTZ00184149 calmodulin; Provisional 92.73
PLN02964 644 phosphatidylserine decarboxylase 92.45
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 92.29
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 92.27
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 92.22
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 91.78
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 91.52
cd0503088 calgranulins Calgranulins: S-100 domain found in p 91.39
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 90.49
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 89.16
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 87.71
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 87.71
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 86.56
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 84.04
cd0021388 S-100 S-100: S-100 domain, which represents the la 83.25
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 82.86
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 82.66
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 82.18
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 81.47
>KOG4629 consensus Predicted mechanosensitive ion channel [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-72  Score=629.19  Aligned_cols=436  Identities=45%  Similarity=0.720  Sum_probs=381.9

Q ss_pred             ccccccCCCCCCCCCCCCCCCCCCCCeeeecCCccccccccccccccccccccccccCCCCCCCCCCCCCcccCCccccc
Q 007331          102 ESLKRRHSNSTNNNYKDSPQKDSEGEVVKCTSNKSFDRNVSFNKKSALLMTKTKSRLMDLPPERIEPKSGRVVGRSGQLK  181 (607)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~k~~srl~~~~~~~~~~~~~~~~~~s~~~~  181 (607)
                      +.+|++..+..... .+..+-.+.+++++||+....         +...+.+++||++|||-+. .+  +++ |++|+..
T Consensus        51 ~~~~~~~~~~~~~~-~~~~~~~~~~~~v~~t~~~~~---------~~~~~~~~~s~~f~p~~~~-~~--n~~-~~~~~~~  116 (714)
T KOG4629|consen   51 GRVRRRSLPYILYS-QEELRRTEYGETVRCTSRKMP---------SMIFFASKRSRDFDPAEPN-NR--NRF-SNSGETT  116 (714)
T ss_pred             chhhhccccceecc-cccccccCCcceEEeccccCh---------HhhhhhhhcccccCCCCCC-CC--Ccc-cCccccc
Confidence            55555555443332 223334577899999997443         4678889999999977222 11  565 7899999


Q ss_pred             ccCCCCCCCCccCCcCCCCCCchHHhhcccchhhHHHHHHHHHHHHHHhhheeecccCcceeeehhHHHHHHHHHHHHHH
Q 007331          182 SGFIGKNVDEEEEDPLLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDYFKKKKLWKLGLWKWELLILVLICG  261 (607)
Q Consensus       182 sg~~~~~~~eeddd~~~d~d~p~~~kk~k~~~~~~iewv~lilil~~LV~sLti~~l~~~~lw~l~LWkW~v~~lVli~G  261 (607)
                      +|..+...+|+|++++..+++|+++++.+..++++|+|+.+++++++++|+|+++......+|.+..|+|++.++|++||
T Consensus       117 s~~~a~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~i~~I~~~~iv~~lv~~l~i~~~~~~~~~~~~~~kw~~~~~v~~~~  196 (714)
T KOG4629|consen  117 SGELAPSEKDEEESIFSEEKLPDETRRSLLSSITVITWILLVLIVSSLVCSLGIHVHRLVTLWSLILWKWLVTLLVRITA  196 (714)
T ss_pred             cccccCCcccccccccchhccchhhhhcccccHHHHHHHHHHHHHHHHHhhhhhheecccceEEEEeeeehhhhHHHHHH
Confidence            99999987789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhchhhhhhhhhhhhhhhheeeeehhhhhhHHHHHHH-HHHHHHHHhhccccccccchhHHHHHHHHHHHHHHH
Q 007331          262 RLVSSWIVRIIVFCIERNFLLRKRVLYFVYGVRKAVQNCLWLG-LVLIAWHCLFDQRVERETNSDVLKYATKILICLWVG  340 (607)
Q Consensus       262 rlVS~WvvrlvV~lIernFllrkrVLYfVygLrk~v~~flWl~-lvLiaw~~Lf~~~v~r~t~t~~l~~VtKVLi~llV~  340 (607)
                      ++++.|.+.++||+++.||++|++++|||||+++.+|+|+|++ +++++|+.+|+..+++.+..+.+.+++++ +|+++.
T Consensus       197 ~lv~~~~~~~vvf~~~~n~~~r~~~l~~v~~~~~~vq~~~~l~~lv~law~~l~d~~v~~~~r~~~l~~~~~~-i~lli~  275 (714)
T KOG4629|consen  197 VLVSSWFAALVVFLIESNFLRRKKVLYFVYGLRKFVQTGIWLGKLVLLAWIFLFDKIVFRKTRAKFLAFVTML-ITLLIT  275 (714)
T ss_pred             HHHHhhHHHHHHHHhhhhHHHHHHHHHHHhhhHHHHHHHHHHhHHHHHHHHHhhhhhhhhhhhhhhhhhhhhh-hhhhHH
Confidence            9999999999999999999999999999999999999999999 99999999999999888777789999999 999999


Q ss_pred             HHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHhHHHHHHhcCCCchhhhhhhHHHHHHHHHHHHhhhCCCCCCCCCCCCc
Q 007331          341 VMLWLVKTLLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEIQKAEEEQERIVSEVQKLQNAGVTIPPGLKSSV  420 (607)
Q Consensus       341 a~l~LvKklLVKlIAsSFH~rtYfDRIqESkf~qyvL~tLsgppl~e~~~~~~Ede~i~~ev~~l~~aG~~~P~~l~~s~  420 (607)
                      ++.|++||+++|+||++||+++|++||||++|+||+|++|||||+.       |+            +|+..++..    
T Consensus       276 ~~~~lv~ti~~kv~as~f~~s~~~~rI~e~~f~q~~l~~Lsg~p~~-------e~------------~gr~s~~~~----  332 (714)
T KOG4629|consen  276 EFMWLVKTILMKVIASSFHRSTYFSRIQESVFTQEVLETLSGPPRE-------ED------------VGRESTFRA----  332 (714)
T ss_pred             HHHhhchhhhhHHHHHHHhHHHHHhhcchhhhhHHHHHHhcCCccc-------cc------------cccccccee----
Confidence            9999999999999999999999999999999999999999999982       21            344322111    


Q ss_pred             CCCcccccccCCCCcccCCCCCCCCccccccCCCCCCCcchhhhhhcCCCccchhhhhhhhhhhhccccchhhHHhhhcc
Q 007331          421 LSSPQSAKVIGSGRLQRTPREGKSPKLSHTFSNKDDDGITIDHLHKLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDST  500 (607)
Q Consensus       421 ~p~~~~~~~~~sGrls~~~~~gks~~l~r~~~~k~~~~I~~~~L~kl~~~nVSAwtmKrl~~~vR~s~LSTls~~l~~a~  500 (607)
                                           +.++...|..    ..+|+++++|+++..+++||+|+++|+.++.+++++++.+++.+.
T Consensus       333 ---------------------~~s~~~~r~~----s~~i~~~~l~~~~~~~~sa~~~~~~~~~~~~~~~t~l~~~~~~s~  387 (714)
T KOG4629|consen  333 ---------------------IFSPGLSRSG----SAKIGMDKLHKIKKKNVSAWNMRRLMTILAAGGLTTLSPGFQLST  387 (714)
T ss_pred             ---------------------eccccccchh----hcccccchhhhhhHhhhcHhhhhHHHHHHhccCcccCCccccccc
Confidence                                 0111111111    122889999999999999999999999999999999999987765


Q ss_pred             CcCCcccccCCHHHHHHHHHHHHHhhcCCCCCccchhhhhccCCHHHHHHHhhhhhhccccCCcCHHHHHHHHHHHHH-H
Q 007331          501 NEDESAPHIKTEYEAKAAARKIFQNVAKPGSKFIYLEDLMRFLNEDEASKTMSLFEEASERKKISKSALKNWVVRIWQ-R  579 (607)
Q Consensus       501 ~~~e~~~eI~Se~eAkalARrIF~nvakpG~~yI~ldDL~rF~~eeEAe~aF~lFD~d~~NGdISk~eL~~wVV~iyr-R  579 (607)
                      .++....+|+|+.+|+++|++||+|+++||..||++||+++|+++|||+.+|++||+..+++ |||+++++|++++|+ |
T Consensus       388 ~~~~~~~~i~s~~~a~~aA~~iF~nv~~p~~~~i~ld~~~~f~~~E~a~~~~slfe~~~~~~-Itrs~~~~~iv~~~~ER  466 (714)
T KOG4629|consen  388 SKDSSIIEIRSEKEAKIAARKIFKNVAKPGVILIDLDDLLRFMGDEEAERAFSLFEGASDEN-ITRSSFKEWIVNIYRER  466 (714)
T ss_pred             cccchhhhhhhhhhHHHHHHHHHhccCCCCccchhhhhhhhcCCHHHHHHHHHhhhhhcccC-ccHHHHHHHHHHHHHHH
Confidence            45567789999999999999999999999999999999999999999999999999986666 999999999999999 9


Q ss_pred             HHHhhhccchhHHHHHHHHHHh
Q 007331          580 MAFSMRVDITKSLFLAIYCLLE  601 (607)
Q Consensus       580 KALA~SLkDtktAV~kLD~vl~  601 (607)
                      |+||++|+|++|||+|||.+|.
T Consensus       467 k~L~~tL~d~~taV~kL~~il~  488 (714)
T KOG4629|consen  467 KALARTLNDTKTAVNKLDRILN  488 (714)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999986

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.9 bits (144), Expect = 2e-09
 Identities = 97/652 (14%), Positives = 181/652 (27%), Gaps = 204/652 (31%)

Query: 50  MDLEMDELQH----------QASNKNNNCGSSSGININSNTK---STQGLPTVSESPTAV 96
           MD E  E Q+           A   N +C      ++    K   S + +  +  S  AV
Sbjct: 7   MDFETGEHQYQYKDILSVFEDAFVDNFDCK-----DVQDMPKSILSKEEIDHIIMSKDAV 61

Query: 97  NRVS--FESLKRRHSN--------STNNNYK--------DSPQKDSEGEVVKCTSNKSFD 138
           +     F +L  +               NYK        +  Q      +     ++ ++
Sbjct: 62  SGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYN 121

Query: 139 RNVSFNKKS---ALLMTKTKSRLMDLPPERIEPKSGRVV--GRSGQLKSGFIGKNV---- 189
            N  F K +        K +  L++L P +       V+  G  G       GK      
Sbjct: 122 DNQVFAKYNVSRLQPYLKLRQALLELRPAK------NVLIDGVLG------SGKTWVALD 169

Query: 190 ---DEEEEDP---------LLEEDLPEEYKKEKISIWVLLEWFSLILIIGALVCSLTIDY 237
                + +           L   + PE   +    +   ++         +    L I  
Sbjct: 170 VCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHS 229

Query: 238 FK--KKKLWKLGLWKWELLIL--VLICGRLVSSWIVRIIVFCIERNFLLRKRVLYFVYGV 293
            +   ++L K   ++  LL+L  V            +         F L  ++L  +   
Sbjct: 230 IQAELRRLLKSKPYENCLLVLLNV---------QNAKAW-----NAFNLSCKIL--LTTR 273

Query: 294 RKAVQNCLWLGLVLIAWHCLFDQRVERETNSDVL-KYATKILICLWVGVMLW-----LVK 347
            K V + L                +  + +S  L     K L+  ++          ++ 
Sbjct: 274 FKQVTDFLSAATT---------THISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLT 324

Query: 348 T--LLVKVLASSFHVSTYFDRIQEALFNQYLIETLSGPPLIEI----QKAEEEQER---- 397
           T    + ++A S              +     + L+   +IE      +  E ++     
Sbjct: 325 TNPRRLSIIAESIRD--GLATWDN--WKHVNCDKLT--TIIESSLNVLEPAEYRKMFDRL 378

Query: 398 -IVSEVQKLQNAGVTIPPGLKSSVLSSPQSAKVIGSGRLQRTPRE--GKSPKLSHTFSNK 454
            +             IP      +LS      +I    ++        K  K S      
Sbjct: 379 SVFPP-------SAHIPT----ILLS------LIWFDVIKSDVMVVVNKLHKYSLVEKQP 421

Query: 455 DDDGITIDHLH-KLNPKNVSAWNMKRLMNIIRHGSLTTLDEQIQDSTNEDESAP------ 507
            +  I+I  ++ +L  K     N   L     H S+       +   ++D   P      
Sbjct: 422 KESTISIPSIYLELKVKLE---NEYAL-----HRSIVDHYNIPKTFDSDDLIPPYLDQYF 473

Query: 508 ------HIKT--EYEAKAAARKIFQNV----AK----------PGS------------KF 533
                 H+K     E     R +F +      K           GS             +
Sbjct: 474 YSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPY 533

Query: 534 I---------YLEDLMRFLNEDEA----SKTMSLFEEA--SERKKISKSALK 570
           I          +  ++ FL + E     SK   L   A  +E + I + A K
Sbjct: 534 ICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEAIFEEAHK 585

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
3akb_A166 Putative calcium binding protein; EF-hand, metal b 96.64
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 96.62
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 96.62
3li6_A66 Calcium-binding protein; calcium signaling protein 96.6
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 96.57
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.55
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 96.53
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 96.45
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 96.43
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 96.42
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 96.39
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 96.33
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 96.25
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 96.24
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 96.2
3a4u_B143 Multiple coagulation factor deficiency protein 2; 96.19
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.18
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 96.15
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.13
1qjt_A99 EH1, epidermal growth factor receptor substrate su 96.13
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 96.12
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 96.12
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.11
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 96.1
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 96.06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 96.03
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.02
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 96.01
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.0
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.0
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 95.96
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 95.96
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.96
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 95.92
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.9
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 95.88
3akb_A166 Putative calcium binding protein; EF-hand, metal b 95.88
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 95.87
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.86
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.83
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 95.83
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 95.8
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.8
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.79
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.79
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 95.79
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 95.77
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.77
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 95.72
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 95.71
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.71
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.7
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.68
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 95.68
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 95.67
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 95.64
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 95.64
1c07_A95 Protein (epidermal growth factor receptor pathway 95.63
3fwb_A161 Cell division control protein 31; gene gating, com 95.61
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.61
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 95.61
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 95.6
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 95.59
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 95.59
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 95.58
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 95.57
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 95.55
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 95.52
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.52
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 95.51
1y1x_A191 Leishmania major homolog of programmed cell death 95.51
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 95.5
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.5
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 95.49
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 95.48
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 95.48
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 95.45
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 95.42
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 95.42
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 95.41
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 95.4
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 95.4
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 95.39
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 95.38
3fwb_A161 Cell division control protein 31; gene gating, com 95.38
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 95.38
1exr_A148 Calmodulin; high resolution, disorder, metal trans 95.36
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 95.35
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 95.35
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 95.33
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.32
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 95.3
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.29
2hps_A186 Coelenterazine-binding protein with bound coelent; 95.27
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 95.26
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 95.26
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.26
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 95.25
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.25
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.24
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 95.24
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.24
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 95.24
1exr_A148 Calmodulin; high resolution, disorder, metal trans 95.23
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 95.22
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.22
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 95.19
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.18
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 95.15
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.11
2jnf_A158 Troponin C; stretch activated muscle contraction, 95.11
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 95.1
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 95.1
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 95.05
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 95.04
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 95.02
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 95.01
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.0
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 94.99
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 94.99
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 94.98
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.98
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 94.96
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 94.96
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.95
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 94.95
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 94.93
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 94.92
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 94.91
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 94.86
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 94.84
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 94.83
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.83
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 94.83
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.79
2jnf_A158 Troponin C; stretch activated muscle contraction, 94.79
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.79
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 94.78
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 94.75
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 94.75
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 94.73
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 94.72
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 94.72
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.71
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 94.69
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 94.68
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 94.67
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 94.64
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.61
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 94.58
1y1x_A191 Leishmania major homolog of programmed cell death 94.58
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 94.57
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 94.55
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 94.55
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.51
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 94.48
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.47
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 94.46
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 94.46
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 94.45
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 94.44
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.44
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 94.43
3lij_A494 Calcium/calmodulin dependent protein kinase with A 94.41
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 94.34
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 94.33
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 94.31
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 94.19
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 94.17
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 94.16
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 94.15
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 94.15
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 94.15
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 94.14
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 94.12
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.09
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 94.05
2jq6_A139 EH domain-containing protein 1; metal binding prot 94.05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 93.99
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 93.96
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 93.94
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 93.92
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 93.9
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 93.83
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 93.81
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 93.78
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 93.77
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 93.75
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 93.74
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 93.73
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 93.71
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 93.7
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 93.67
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 93.62
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 93.62
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 93.61
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 93.6
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 93.52
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 93.45
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 93.45
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 93.43
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 93.41
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 93.28
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 93.16
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 93.12
3lij_A494 Calcium/calmodulin dependent protein kinase with A 93.03
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 92.97
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 92.93
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 92.84
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 92.81
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 92.74
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 92.72
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 92.7
3a4u_B143 Multiple coagulation factor deficiency protein 2; 92.67
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 92.63
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 92.58
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 92.54
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 92.53
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 92.47
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 92.43
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 92.42
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 92.29
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 92.28
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 92.09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 92.04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 91.91
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 91.72
2lv7_A100 Calcium-binding protein 7; metal binding protein; 91.7
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 91.65
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 91.58
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 91.26
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 91.05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 90.93
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 90.86
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 90.82
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 90.57
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 90.51
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 90.49
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 90.21
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 89.94
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 89.9
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 89.79
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 89.7
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 89.65
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 89.22
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 89.17
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 88.78
1c07_A95 Protein (epidermal growth factor receptor pathway 88.69
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 88.55
3li6_A66 Calcium-binding protein; calcium signaling protein 88.52
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 88.46
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 88.44
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 88.35
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 88.31
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 88.05
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 87.98
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 87.97
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 87.81
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 87.7
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 87.51
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 87.37
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 87.29
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 87.2
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 86.83
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 86.83
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 86.79
1avs_A90 Troponin C; muscle contraction, calcium-activated, 86.79
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 86.7
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 86.52
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 85.98
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 85.95
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 85.8
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 85.77
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 85.75
1qjt_A99 EH1, epidermal growth factor receptor substrate su 85.42
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 85.29
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 85.01
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 84.73
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 84.69
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 84.44
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 83.9
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 83.57
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 83.41
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 82.48
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 82.36
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 81.78
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 80.86
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 80.7
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 80.57
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 80.09
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
Probab=96.64  E-value=0.0034  Score=54.95  Aligned_cols=61  Identities=15%  Similarity=0.202  Sum_probs=54.4

Q ss_pred             HHHHHHHHHhhcCCCCCccchhhhhccC-----CHHHHHHHhhhhhhccccCCcCHHHHHHHHHHHH
Q 007331          516 KAAARKIFQNVAKPGSKFIYLEDLMRFL-----NEDEASKTMSLFEEASERKKISKSALKNWVVRIW  577 (607)
Q Consensus       516 kalARrIF~nvakpG~~yI~ldDL~rF~-----~eeEAe~aF~lFD~d~~NGdISk~eL~~wVV~iy  577 (607)
                      ....+.+|+.+...|..+|..++|..++     +++++++.|..+|.+ ++|.||.+|+...+.+.|
T Consensus        97 ~~~~~~~F~~~D~d~~G~i~~~E~~~~l~~~~~~~~~~~~~~~~~D~d-~dg~i~~~ef~~~~~~~~  162 (166)
T 3akb_A           97 RPFLHAALGVADTDGDGAVTVADTARALTAFGVPEDLARQAAAALDTD-GDGKVGETEIVPAFARYF  162 (166)
T ss_dssp             HHHHHHHHHHHCSSSSSCCBHHHHHHHHHHTTCCHHHHHHHHHHHCTT-CSSBCCHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhCCCCCCcCCHHHHHHHHHHhCCCHHHHHHHHHHhCCC-CCCcCcHHHHHHHHHHHh
Confidence            4457899999999999999999998764     689999999999999 899999999999887665
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.25
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.2
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.0
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 96.7
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 96.53
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.5
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 96.41
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 96.26
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.24
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 96.23
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 96.15
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 96.11
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 96.08
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.04
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.95
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 95.94
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 95.88
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 95.81
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 95.8
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.74
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 95.71
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 95.67
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 95.6
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 95.59
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.53
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.43
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 95.38
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.37
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.36
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.31
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 95.19
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.12
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 95.09
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 95.01
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 94.9
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 94.88
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 94.88
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 94.83
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.82
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.8
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.76
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 94.74
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 94.68
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 94.68
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 94.63
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 94.61
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 94.54
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 94.49
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 94.41
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.39
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 94.39
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 94.38
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.27
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.22
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 93.91
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 93.71
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 93.7
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 93.68
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.29
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 93.25
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.17
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 93.07
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 93.01
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 93.01
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 92.89
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 92.83
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 92.75
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 92.73
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 92.61
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 92.59
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 92.38
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 92.33
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 92.29
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 92.18
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.97
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.8
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.77
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 91.65
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 91.65
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 91.52
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 91.34
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 91.34
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 91.31
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 91.3
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 91.22
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 91.09
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 91.0
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 90.63
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 90.63
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 90.5
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 90.49
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 90.28
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 90.21
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 89.99
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.91
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 89.83
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 89.65
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 89.13
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 89.09
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.76
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 88.73
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 87.72
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 87.61
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 87.18
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 87.06
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.97
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 86.81
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 86.6
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 86.59
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 86.18
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.03
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 85.84
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 85.05
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 84.22
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 84.17
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 82.14
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 81.51
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 81.47
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 80.64
d1qv0a_ 189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 80.62
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 80.59
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 80.54
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Human (Homo sapiens), cardiac isoform [TaxId: 9606]

Probab=97.25  E-value=9.1e-05  Score=51.51  Aligned_cols=28  Identities=21%  Similarity=0.405  Sum_probs=25.9

Q ss_pred             CHHHHHHHhhhhhhccccCCcCHHHHHHH
Q 007331          544 NEDEASKTMSLFEEASERKKISKSALKNW  572 (607)
Q Consensus       544 ~eeEAe~aF~lFD~d~~NGdISk~eL~~w  572 (607)
                      ++||-.+||.+||+| +||.||.+||+..
T Consensus         1 seeel~eAF~~FDkD-g~G~Is~~EL~~v   28 (33)
T d2hf5a1           1 SEEEIREAFRVFDKD-GNGYISAAELRHV   28 (33)
T ss_dssp             CHHHHHHHHHHHSSS-CCSCBCHHHHHHH
T ss_pred             CHHHHHHHHHHhCCC-CCCcCcHHHHHHH
Confidence            478999999999999 9999999999984
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure