Citrus Sinensis ID: 007338

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGLWSNWFQVQRLLLKKLFDVEWLIQAELLLEDTLMEHS
cccccccEEEECcccccccccEEECccccccccccCEEcccccEEEEEEEEccccccccccEEEEEEEcccccEEEcccccccccccccccEEEECcccEEEEEEcccccccccccccccccEEEEccccccccccccccccccHHHHHHHccccccEEEEEEcccccEECccccccccccccccccEEEEEEEccccccccccccccCEEEEEcccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEccccccccccccEEEcccccccccccccccEEEEEEEEEccccEEEEEEcccccccccEEEEEccccccccccccccEEEcccccEEEEEEcccccccEEEEEEccccccccccccEEEEccccccCEEEEEEcccccEEEEEEEEcccccccccccccEEEEEEEcccccccEEEEEccccccccccccccccccccccccEEEEEEcccccEEEEEEEccccccccccccccEEEEEccccccccccccccccccccccccccccHHHHHHccEEEECcccccEEcccccccHHHHHHHHHcHHHHHHHHHHHcccccccccccc
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPS***********************NIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKS***********NEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGLWSNWFQVQRLLLKKLFDVEWLIQAELLLEDTLM***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGLWSNWFQVQRLLLKKLFDVEWLIQAELLLEDTLMEHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glutamyl endopeptidase, chloroplastic Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.probableQ10MJ1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GOP, chain A
Confidence level:very confident
Coverage over the Query: 4-109,140-224
View the alignment between query and template
View the model in PyMOL
Template: 1K32, chain A
Confidence level:very confident
Coverage over the Query: 5-194,209-261,275-381,398-470
View the alignment between query and template
View the model in PyMOL
Template: 4A5S, chain A
Confidence level:confident
Coverage over the Query: 6-105,156-381,398-603
View the alignment between query and template
View the model in PyMOL
Template: 3AZO, chain A
Confidence level:confident
Coverage over the Query: 5-109,130-131,146-226,296-378,395-523,538-603
View the alignment between query and template
View the model in PyMOL
Template: 3C5M, chain A
Confidence level:confident
Coverage over the Query: 18-106,156-227,241-376,390-464
View the alignment between query and template
View the model in PyMOL